Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXF0ZW)

• DTT Name: Inward rectifier potassium channel Kir2.3 (KCNJ4)
• Synonyms: Potassium channel, inwardly rectifying subfamily J member 4; Inward rectifier potassium channel 4; Inward rectifier K(+) channel Kir2.3; IRK3; IRK-3; Hippocampal inward rectifier; HRK1; HIRK2; HIR
• Gene Name: KCNJ4
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Inward rectifier potassium channel
• UniProt ID: KCNJ4_HUMAN
• TTD ID: T07740
• Sequence:
  MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
  IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
  FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
  RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
  DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
  TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
  LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
  SHLDLERMQASLPLDNISYRRESAI
• Function: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity).
• KEGG Pathway:
  Cholinergic synapse (hsa04725)
  Oxytocin signaling pathway (hsa04921)
• Reactome Pathway:
  Classical Kir channels (R-HSA-1296053)
  Phase 4 - resting membrane potential (R-HSA-5576886)
  Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits (R-HSA-997272)
  Activation of G protein gated Potassium channels (R-HSA-1296041)

Molecular Interaction Atlas (MIA) of This DTT

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
rose bengal (photoactivated)	DM3NBQ6	Discovery agent	N.A.	Investigative	[1]
[14C]TEA	DM6SFYH	Discovery agent	N.A.	Investigative	[2]

References

• [1] Susceptibility of cloned K+ channels to reactive oxygen species. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11796-800.
• [2] Cloning and expression of a novel human brain inward rectifier potassium channel. J Biol Chem. 1994 Aug 12;269(32):20468-74.