Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXMI0C)

• DTT Name: Phosphomevalonate kinase (PMVK)
• Synonyms: hPMK; PMKase; PMKI
• Gene Name: PMVK
• DTT Type: Literature-reported target; [1]
• UniProt ID: PMVK_HUMAN
• TTD ID: T53892
• EC Number: EC 2.7.4.2
• Sequence:
  MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ
  RLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFRE
  AYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ
  LENLIEFIRSRL
• Function: Regulated in response to dietary sterol levels and that this regulation is coordinate with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis.
• KEGG Pathway:
  Terpenoid backbone biosynthesis (hsa00900)
  Metabolic pathways (hsa01100)
  Peroxisome (hsa04146)
• Reactome Pathway:
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
  Cholesterol biosynthesis (R-HSA-191273)
• BioCyc Pathway: MetaCyc:HS08830-MON

Molecular Interaction Atlas (MIA) of This DTT

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(R)-5-diphosphomevalonate	DMOESL1	Discovery agent	N.A.	Investigative	[2]
3-hydroxy-3-methyl-6-phosphohexanoic acid	DM3YO72	Discovery agent	N.A.	Investigative	[3]
cinnamic acid	DM340FH	Discovery agent	N.A.	Investigative	[1]
isoferulic acid	DMN23KT	Discovery agent	N.A.	Investigative	[1]

References

• [1] Inhibition of rat liver mevalonate pyrophosphate decarboxylase and mevalonate phosphate kinase by phenyl and phenolic compounds. Biochem J. 1979 Jul 1;181(1):143-51.
• [2] Functional evaluation of conserved basic residues in human phosphomevalonate kinase. Biochemistry. 2007 Oct 23;46(42):11780-8.
• [3] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 641).