Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTXQPKC)
| DTT Name | Human papillomavirus E2 transactivator messenger RNA (HPV E2 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | Regulatory protein E2 (mRNA) | ||||
| Gene Name | HPV E2 mRNA | ||||
| DTT Type | 
                     Discontinued target 
                 | 
                [1] | |||
| BioChemical Class | 
                     mRNA target 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| Sequence | 
                                         
                            MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNH 
                        
                    QVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQT VQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSEC EKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTY GQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLK CLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILV GYMTM  | 
            ||||
| Function | 
                                         
                        A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex. Plays a role in the initiation of viral DNA replication.
                        
                     
                                     | 
            ||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Discontinued Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
