Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXQPKC)

• DTT Name: Human papillomavirus E2 transactivator messenger RNA (HPV E2 mRNA)
• Synonyms: Regulatory protein E2 (mRNA)
• Gene Name: HPV E2 mRNA
• DTT Type: Discontinued target; [1]
• BioChemical Class: mRNA target
• UniProt ID: VE2_HPV18
• TTD ID: T12279
• Sequence:
  MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNH
  QVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQT
  VQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSEC
  EKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTY
  GQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLK
  CLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILV
  GYMTM
• Function: A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex. Plays a role in the initiation of viral DNA replication.

Molecular Interaction Atlas (MIA) of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 2105	DMR2STB	Human papillomavirus infection	1A9Y	Discontinued in Phase 2	[1]

References

• [1] US patent application no. 5,665,580, Antisense oligonucleotide inhibition of papillomavirus transformed cells.