Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTY9TWO)

DTT Name	Transforming growth factor beta 2 (TGFB2)
Synonyms	Transforming growth factor beta-2 proprotein; TGF-beta 2; Polyergin; Glioblastoma-derived T-cell suppressor factor; G-TSF; Cetermin; BSC-1 cell growth inhibitor
Gene Name	TGFB2
DTT Type	Clinical trial target	[1]
BioChemical Class	Growth factor
UniProt ID	TGFB2_HUMAN
TTD ID	T14143
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Function	Transforming growth factor beta-2 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) Cytokine-cytokine receptor interaction (hsa04060 ) FoxO signaling pathway (hsa04068 ) Cell cycle (hsa04110 ) Endocytosis (hsa04144 ) TGF-beta signaling pathway (hsa04350 ) Osteoclast differentiation (hsa04380 ) Hippo signaling pathway (hsa04390 ) Leishmaniasis (hsa05140 ) Chagas disease (American trypanosomiasis) (hsa05142 ) Malaria (hsa05144 ) Toxoplasmosis (hsa05145 ) Amoebiasis (hsa05146 ) Tuberculosis (hsa05152 ) Hepatitis B (hsa05161 ) HTLV-I infection (hsa05166 ) Pathways in cancer (hsa05200 ) Proteoglycans in cancer (hsa05205 ) MicroRNAs in cancer (hsa05206 ) Colorectal cancer (hsa05210 ) Renal cell carcinoma (hsa05211 ) Pancreatic cancer (hsa05212 ) Chronic myeloid leukemia (hsa05220 ) Inflammatory bowel disease (IBD) (hsa05321 ) Rheumatoid arthritis (hsa05323 ) Hypertrophic cardiomyopathy (HCM) (hsa05410 ) Dilated cardiomyopathy (hsa05414 )
Reactome Pathway	Molecules associated with elastic fibres (R-HSA-2129379 ) ECM proteoglycans (R-HSA-3000178 ) Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AP12009	DMUYOC8	Colorectal cancer	2B91.Z	Phase 3	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Lerdelimumab	DME91CG	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	9.75E-02	0.41	1.1
------------------------------------------------------------------------------------

References

1	Design and development of antisense drugs. Expert Opin. Drug Discov. 2008 3(10):1189-1207.
2	A phase III study of subconjunctival human anti-transforming growth factor beta(2) monoclonal antibody (CAT-152) to prevent scarring after first-time trabeculectomy. Ophthalmology. 2007 Oct;114(10):1822-30.