Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYAWV0)

• DTT Name: Plasmodium Acetyl-CoA carboxylase 1 (Malaria ACC1)
• Synonyms: Acetyl-CoA carboxylase; ACC1; ACC-alpha
• Gene Name: Malaria ACC1
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Carbon-carbon ligase
• UniProt ID: Q9U752_PLAFA
• TTD ID: T52188
• Sequence:
  SQGGGGKGIRKVENEYEIKKAYEQVQNELPNSPIFLMKVCNNVRHIEIQVVGDMYGNVCS
  LSGRDCTTQRRFQKIFEEGPPSVVPYPIFREMEKSSIRLTKMIKYRGAGTIEYLYDQINK
  KYFFLELNPRL
• Function: Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. This protein carries three functions: biotin carboxyl carrier protein, biotin carboxylase, and carboxyltransferase.
• KEGG Pathway:
  Fatty acid biosynthesis (hsa00061)
  Pyruvate metabolism (hsa00620)
  Propanoate metabolism (hsa00640)
  Metabolic pathways (hsa01100)
  Fatty acid metabolism (hsa01212)
  AMPK signaling pathway (hsa04152)
  Insulin signaling pathway (hsa04910)
  Glucagon signaling pathway (hsa04922)
• Reactome Pathway:
  Import of palmitoyl-CoA into the mitochondrial matrix (R-HSA-200425)
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
  Fatty Acyl-CoA Biosynthesis (R-HSA-75105)
  ChREBP activates metabolic gene expression (R-HSA-163765)

Molecular Interaction Atlas (MIA) of This DTT

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
A-80040	DML20N9	Discovery agent	N.A.	Investigative	[2]
AC-8632	DM09BJ4	Parkinson disease	8A00.0	Investigative	[1]
Clodinafop	DMALRU9	Discovery agent	N.A.	Investigative	[3]
CP-640186	DMO0PS9	Discovery agent	N.A.	Investigative	[4]
Haloxyfop	DM5SULN	Discovery agent	N.A.	Investigative	[3]
Quizalofop	DM9KMEI	Discovery agent	N.A.	Investigative	[3]

References

• [1] Reduced food intake and body weight in mice treated with fatty acid synthase inhibitors. Science. 2000 Jun 30;288(5475):2379-81.
• [2] Synthesis and structure-activity relationships of N-{3-[2-(4-alkoxyphenoxy)thiazol-5-yl]-1- methylprop-2-ynyl}carboxy derivatives as selective acet... J Med Chem. 2006 Jun 29;49(13):3770-3.
• [3] The apicoplast as an antimalarial drug target. Drug Resist Updat. 2001 Jun;4(3):145-51.
• [4] Discovery of small molecule isozyme non-specific inhibitors of mammalian acetyl-CoA carboxylase 1 and 2. Bioorg Med Chem Lett. 2010 Apr 1;20(7):2383-8.