Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTYUMF5)
| DTT Name | Fast skeletal muscle troponin complex (TNNC2) | ||||
|---|---|---|---|---|---|
| Synonyms |
fTnT; Troponin T, fast skeletal muscle; Troponin I, fast-twitch isoform; Troponin I, fast skeletal muscle; Troponin C, skeletal muscle; TnTf; TNNT3; TNNI2; TNNC2; Fast skeletal muscle troponin T; Beta-TnTF
|
||||
| Gene Name | TNNC2 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Troponin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ |
||||
| Function | Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
