Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTYUMF5)
DTT Name | Fast skeletal muscle troponin complex (TNNC2) | ||||
---|---|---|---|---|---|
Synonyms |
fTnT; Troponin T, fast skeletal muscle; Troponin I, fast-twitch isoform; Troponin I, fast skeletal muscle; Troponin C, skeletal muscle; TnTf; TNNT3; TNNI2; TNNC2; Fast skeletal muscle troponin T; Beta-TnTF
|
||||
Gene Name | TNNC2 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Troponin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ |
||||
Function | Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||