| DTT Name |
HUMAN valosin-containing protein p97 (VCP)
|
| Synonyms |
Valosin-containing protein; Transitional endoplasmic reticulum ATPase; TER ATPase; 15S Mg(2+)-ATPase p97 subunit |
| Gene Name |
VCP
|
| BioChemical Class |
AAA ATPase family
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| EC Number |
EC 3.6.4.6
|
| Sequence |
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG AGPSQGSGGGTGGSVYTEDNDDDLYG
|
| Function |
Human protein valosin containing protein interacts with SARS-CoV-2 Orf10 protein with high significance, which indicates VCP as a potential therapeutic target. |
| KEGG Pathway |
- Protein processing in endoplasmic reticulum (hsa04141 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Legionellosis (hsa05134 )
|
| Reactome Pathway |
- HSF1 activation (R-HSA-3371511 )
- ABC-family proteins mediated transport (R-HSA-382556 )
- N-glycan trimming in the ER and Calnexin/Calreticulin cycle (R-HSA-532668 )
- Hedgehog ligand biogenesis (R-HSA-5358346 )
- Hh mutants are degraded by ERAD (R-HSA-5362768 )
- Defective CFTR causes cystic fibrosis (R-HSA-5678895 )
- Josephin domain DUBs (R-HSA-5689877 )
- Ovarian tumor domain proteases (R-HSA-5689896 )
- Neutrophil degranulation (R-HSA-6798695 )
- E3 ubiquitin ligases ubiquitinate target proteins (R-HSA-8866654 )
- Protein methylation (R-HSA-8876725 )
- Neddylation (R-HSA-8951664 )
- RHOH GTPase cycle (R-HSA-9013407 )
- Aggrephagy (R-HSA-9646399 )
- Attachment and Entry (R-HSA-9678110 )
- Attachment and Entry (R-HSA-9694614 )
- KEAP1-NFE2L2 pathway (R-HSA-9755511 )
- Translesion Synthesis by POLH (R-HSA-110320 )
|
|
|
|
|
|
|