Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYXPCO)

• DTT Name: P2Y purinoceptor 11 (P2RY11)
• Synonyms: P2Y11
• Gene Name: P2RY11
• DTT Type: Discontinued target; [1]
• UniProt ID: P2Y11_HUMAN
• TTD ID: T92689
• Sequence:
  MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
  WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
  TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
  SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
  AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
  VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
  APKPSEPQSRELSQ
• Function: Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  P2Y receptors (R-HSA-417957)
  G alpha (s) signalling events (R-HSA-418555)
  ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821)
  G alpha (q) signalling events (R-HSA-416476)

Molecular Interaction Atlas (MIA) of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INS 316	DMTHMEI	Lung cancer	2C25.0	Discontinued in Phase 3	[1]

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2MeSATP	DMUE0W6	Discovery agent	N.A.	Investigative	[2]
ATPgammaS	DMXHQIN	Discovery agent	N.A.	Investigative	[2]
BzATP	DM37GYA	Discovery agent	N.A.	Investigative	[2]
dATP	DMMXFBJ	Discovery agent	N.A.	Investigative	[2]
NAADP	DM51DW6	Discovery agent	N.A.	Investigative	[3]
NF157	DMGMH8T	Discovery agent	N.A.	Investigative	[4]
NF340	DMPSXR8	Discovery agent	N.A.	Investigative	[5]
NF546	DMPZB31	Discovery agent	N.A.	Investigative	[6]

References

• [1] Characterization of a Ca2+ response to both UTP and ATP at human P2Y11 receptors: evidence for agonist-specific signaling. Mol Pharmacol. 2003 Jun;63(6):1356-63.
• [2] Pharmacological characterization of the human P2Y11 receptor. Br J Pharmacol. 1999 Nov;128(6):1199-206.
• [3] NAADP+ is an agonist of the human P2Y11 purinergic receptor. Cell Calcium. 2008 Apr;43(4):344-55.
• [4] Synthesis and structure-activity relationships of suramin-derived P2Y11 receptor antagonists with nanomolar potency. J Med Chem. 2005 Nov 3;48(22):7040-8.
• [5] Invited Lectures : Overviews Purinergic signalling: past, present and future. Purinergic Signal. 2006 May;2(1):1-324.
• [6] NF546 [4,4'-(carbonylbis(imino-3,1-phenylene-carbonylimino-3,1-(4-methyl-phenylene)-carbonylimino))-bis(1,3-xylene-alpha,alpha'-diphosphonic acid) tetrasodium salt] is a non-nucleotide P2Y11 agonist and stimulates release of interleukin-8 from human monocyte-derived dendritic cells. J Pharmacol Exp Ther. 2010 Jan;332(1):238-47.