Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZ3P4W)

DTT Name B-cell maturation protein (TNFRSF17)
Synonyms Tumor necrosis factor receptor superfamily member 17; CD269; BCMA; BCM
Gene Name TNFRSF17
DTT Type
Successful target
 [1]
UniProt ID
TNR17_HUMAN
TTD ID
T66693
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE
YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
ISAR
Function Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Intestinal immune network for IgA production (hsa04672 )
Reactome Pathway
TNFs bind their physiological receptors (R-HSA-5669034 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
4 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Belantamab mafodotin DMBT3AI Multiple myeloma 2A83 Approved [2]
Elranatamab DMG1MW2 Multiple myeloma 2A83 Approved [3]
Idecabtagene vicleucel DMP1QTS Multiple myeloma 2A83 Approved [4]
Teclistamab DMGR8JI Multiple myeloma 2A83 Approved [5]
------------------------------------------------------------------------------------
62 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ciltacabtagene autoleucel DMU2J7Y Multiple myeloma 2A83 Phase 3 [6]
Bb2121 DMB0UF9 Multiple myeloma 2A83 Phase 2 [7]
Descartes-08 DM63P1W Multiple myeloma 2A83 Phase 2 [8]
Descartes-11 DM1UO4S Multiple myeloma 2A83 Phase 2 [9]
LCAR-B38M CAR-T Cell DMQZJNA Multiple myeloma 2A83 Phase 2 [1]
Anti-BCMA CAR-T cells DM4D3YF Multiple myeloma 2A83 Phase 1/2 [10]
Anti-BCMA-CAR-transduced T cells DMZ18IO leukaemia 2A60-2B33 Phase 1/2 [11]
AUTO2 DM0PWX2 Multiple myeloma 2A83 Phase 1/2 [12]
BCMA CAR T cells DMH70A9 Multiple myeloma 2A83 Phase 1/2 [13]
BCMA CAR-T DM1DHPO Multiple myeloma 2A83 Phase 1/2 [14]
CAR-T cells targeting BCMA DMENIQ7 leukaemia 2A60-2B33 Phase 1/2 [15]
CART-19/BCMA DMVW1GY Multiple myeloma 2A83 Phase 1/2 [16]
CART-BCMA cells DMWOYNT Multiple myeloma 2A83 Phase 1/2 [17]
CD38 and BCMA CAR-T Cells DMFZS8A Multiple myeloma 2A83 Phase 1/2 [18]
JCARH125 DM8P7FC Multiple myeloma 2A83 Phase 1/2 [19]
JNJ-68284528 DMD9X6U Multiple myeloma 2A83 Phase 1/2 [20]
PBCAR269A DMSGM2L Multiple myeloma 2A83 Phase 1/2 [21]
REGN5458 DMAGX0Q Multiple myeloma 2A83 Phase 1/2 [22]
REGN5459 DMRE0LU Multiple myeloma 2A83 Phase 1/2 [23]
ALLO-715 DMHE3MD Multiple myeloma 2A83 Phase 1 [24]
AMG 420 DMYFZLA Multiple myeloma 2A83 Phase 1 [25]
AMG 701 DM6IT3M Multiple myeloma 2A83 Phase 1 [26]
Anti-BCMA CAR T cells DM3OFZC Multiple myeloma 2A83 Phase 1 [27]
Anti-BCMA CAR-T cells DM2TFUD Multiple myeloma 2A83 Phase 1 [28]
Anti-BCMA CAR-T cells DMK25QD leukaemia 2A60-2B33 Phase 1 [29]
Anti-BCMA CART Cells DMUKNDO Multiple myeloma 2A83 Phase 1 [30]
Anti-CD19/BCMA CAR-T cells DMF93T2 Multiple myeloma 2A83 Phase 1 [31]
Autologous Anti-BCMA-CAR-expressing CD4+/CD8+ T-lymphocytes FCARH143 DMKNMAE Plasma cell myeloma 2A83.1 Phase 1 [32]
Bb21217 DMSBWAQ Multiple myeloma 2A83 Phase 1 [33]
BCMA CAR-T Cells DMJ4W5V Multiple myeloma 2A83 Phase 1 [34]
BCMA CART DMJ37LH Multiple myeloma 2A83 Phase 1 [35]
BCMA CART and huCART19 DM2V4EO Multiple myeloma 2A83 Phase 1 [35]
BCMA nanobody CAR-T cells DMZDLHV Multiple myeloma 2A83 Phase 1 [36]
BCMA-CD19 cCAR DMZ13WQ Multiple myeloma 2A83 Phase 1 [37]
BCMA-CS1 cCAR DMEPHMR Multiple myeloma 2A83 Phase 1 [38]
BCMA-specific CAR-expressing T Lymphocytes DMW0ZDF Plasma cell myeloma 2A83.1 Phase 1 [39]
C-CAR088 DMT35N2 Multiple myeloma 2A83 Phase 1 [40]
CAR-T cells targeting BCMA DMTZADW Multiple myeloma 2A83 Phase 1 [41]
CART-BCMA DMVK3M2 Multiple myeloma 2A83 Phase 1 [42]
CART-ddBCMA DM4OWJ8 Multiple myeloma 2A83 Phase 1 [43]
CC-93269 DM1M4B8 Multiple myeloma 2A83 Phase 1 [44]
CC-98633 DM69YM1 Multiple myeloma 2A83 Phase 1 [45]
CC-99712 DM1UEBR Multiple myeloma 2A83 Phase 1 [46]
CT053 DMBCJW6 Multiple myeloma 2A83 Phase 1 [47]
CTX120 DMWS40H Multiple myeloma 2A83 Phase 1 [48]
HPN217 DMI0KQW Multiple myeloma 2A83 Phase 1 [49]
IM21 CART DMTNYIB Multiple myeloma 2A83 Phase 1 [50]
KITE-585 DMXR6HI Multiple myeloma 2A83 Phase 1 [51]
LCAR-B4822M CAR-T Cell DMEY2LK Multiple myeloma 2A83 Phase 1 [52]
MEDI2228 DMX0DUH Multiple myeloma 2A83 Phase 1 [53]
P-BCMA-101 CAR-T cells DMDC9TB Multiple myeloma 2A83 Phase 1 [54]
P-PSMA-101 DMY2GDQ Prostate cancer 2C82.0 Phase 1 [55]
PHE885 DMBZ2QT Multiple myeloma 2A83 Phase 1 [56]
RG6296 DMEFUSJ Multiple myeloma 2A83 Phase 1 [57]
RG6538 DMTRKEB Multiple myeloma 2A83 Phase 1 [58]
SEA-BCMA DM7NP1K Multiple myeloma 2A83 Phase 1 [59]
TNB-383B DMAI0SH Multiple myeloma 2A83 Phase 1 [60]
WVT078 DM7MS10 Multiple myeloma 2A83 Phase 1 [61]
BCMA-CART DMCEPKM Multiple myeloma 2A83 Clinical trial [62]
BCMA-UCART DMWXGRQ Multiple myeloma 2A83 Clinical trial [63]
CAR-BCMA T cell DMLF2UY Multiple myeloma 2A83 Clinical trial [64]
CAR-T cells targeting BCMA DMGW10M Multiple myeloma 2A83 Clinical trial [65]
------------------------------------------------------------------------------------
⏷ Show the Full List of 62 Clinical Trial Drug(s)
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
P-BCMA-ALL01 DMNIM96 Multiple myeloma 2A83 Preclinical [66]
------------------------------------------------------------------------------------

References

1 ClinicalTrials.gov (NCT03758417) A Study of LCAR-B38M CAR-T Cells, a Chimeric Antigen Receptor T-cell (CAR-T) Therapy Directed Against B-cell Maturation Antigen (BCMA) in Chinese Participants With Relapsed or Refractory Multiple Myeloma
2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
3 FDA Approved Drug Products from FDA Official Website. 2023. Application Number: 761345
4 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services.
5 FDA Approved Drug Products from FDA Official Website. 2022. Application Number: 761291.
6 ClinicalTrials.gov (NCT04181827) A Study Comparing JNJ-68284528, a CAR-T Therapy Directed Against B-cell Maturation Antigen (BCMA), Versus Pomalidomide, Bortezomib and Dexamethasone (PVd) or Daratumumab, Pomalidomide and Dexamethasone (DPd) in Participants With Relapsed and Lenalidomide-Refractory Multiple Myeloma (CARTITUDE-4). U.S. National Institutes of Health.
7 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
8 ClinicalTrials.gov (NCT03448978) Autologous CD8+ T-cells Expressing an Anti-BCMA CAR in Patients With Myeloma
9 Clinical pipeline report, company report or official report of Cartesian Therapeutics.
10 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
11 ClinicalTrials.gov (NCT02954445) A Clinical Research of BCMA-Targeted CAR-T in B Cell Malignancies
12 ClinicalTrials.gov (NCT03287804) APRIL CAR T Cells (AUTO2) Targeting BCMA and TACI for the Treatment of Multiple Myeloma
13 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
14 ClinicalTrials.gov (NCT03322735) Study of BCMA CAR-T in Multiple Myeloma
15 ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
16 ClinicalTrials.gov (NCT03455972) Study of T Cells Targeting CD19/BCMA (CART-19/BCMA) for High Risk Multiple Myeloma Followed With Auto-HSCT
17 ClinicalTrials.gov (NCT03196414) Study of CART-138/BCMA Therapy for R/R Multiple Myeloma
18 ClinicalTrials.gov (NCT03767751) A Feasibility and Safety Study of Dual Specificity CD38 and BCMA CAR-T Cell Immunotherapy for Relapsed or Refractory Multiple Myeloma
19 ClinicalTrials.gov (NCT03436771) Long-term Follow-up Study for Patients Previously Treated With a Juno CAR T-Cell Product
20 ClinicalTrials.gov (NCT03548207) A Study of JNJ-68284528, a Chimeric Antigen Receptor T Cell (CAR-T) Therapy Directed Against B-Cell Maturation Antigen (BCMA) in Participants With Relapsed or Refractory Multiple Myeloma
21 Clinical pipeline report, company report or official report of Precision Biosciences.
22 A BCMAxCD3 bispecific T cell-engaging antibody demonstrates robust antitumor efficacy similar to that of anti-BCMA CAR T cells. Blood Adv. 2021 Mar 9;5(5):1291-1304.
23 Clinical pipeline report, company report or official report of Regeneron Pharmaceuticals.
24 Clinical pipeline report, company report or official report of Allogene Therapeutics.
25 Anti-B-Cell Maturation Antigen BiTE Molecule AMG 420 Induces Responses in Multiple Myeloma. J Clin Oncol. 2020 Mar 10;38(8):775-783.
26 Clinical pipeline report, company report or official report of Amgen.
27 ClinicalTrials.gov (NCT03559764) Study of BCMA CAR-T in Multiple Myeloma
28 ClinicalTrials.gov (NCT03093168) BCMA Chimeric Antigen Receptor Expressing T Cells in Multiple Myeloma
29 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
30 ClinicalTrials.gov (NCT03767725) Anti-BCMA or/and Anti-CD19 CART Cells Treatment of Relapsed Multiple Myeloma
31 ClinicalTrials.gov (NCT03706547) Anti-CD19/BCMA Bispecific CAR-T Cell Therapy for R/R MM
32 ClinicalTrials.gov (NCT03338972) Immunotherapy With BCMA CAR-T Cells in Treating Patients With BCMA Positive Relapsed or Refractory Multiple Myeloma
33 ClinicalTrials.gov (NCT03274219) Study of bb21217 in Multiple Myeloma
34 ClinicalTrials.gov (NCT03661554) BCMA Nano Antibody CAR-T Cells for Patients With Refractory and Relapsed Multiple Myeloma
35 ClinicalTrials.gov (NCT03549442) Up-front CART-BCMA With or Without huCART19 in High-risk Multiple Myeloma
36 ClinicalTrials.gov (NCT03664661) BCMA-CAR-T in Relapsed/Refractory Multiple Myeloma
37 Clinical pipeline report, company report or official report of iCell Gene Therapeutics.
38 ClinicalTrials.gov (NCT04156269) BCMA-CS1 Compound CAR (cCAR) T Cells for Relapsed/Refractory Multiple Myeloma. U.S. National Institutes of Health.
39 ClinicalTrials.gov (NCT03502577) BCMA-Specific CAR T-Cells Combined With a Gamma Secretase Inhibitor (LY3039478) to Treat Relapsed or Persistent Multiple Myeloma
40 ClinicalTrials.gov (NCT03751293) A Study of BCMA-directed CAR-T Cells Treatment in Subjects With r/r Multiple Myeloma
41 ClinicalTrials.gov (NCT03672253) CAR-T Re-treatment for Refractory/Relapsed Multiple Myeloma
42 ClinicalTrials.gov (NCT02546167) CART-BCMA Cells for Multiple Myeloma
43 Clinical pipeline report, company report or official report of Arcellx.
44 T-cell redirecting bispecific antibodies targeting BCMA for the treatment of multiple myeloma. Oncotarget. 2020 Nov 10;11(45):4076-4081.
45 ClinicalTrials.gov (NCT04394650) A Study of CC-98633, BCMA-targeted Chimeric Antigen Receptor (CAR) T Cells, in Subjects With Relapsed and/or Refractory Multiple Myeloma. U.S. National Institutes of Health.
46 ClinicalTrials.gov (NCT04036461) A Study of CC-99712, a BCMA Antibody-Drug Conjugate, in Subjects With Relapsed and Refractory Multiple Myeloma. U.S. National Institutes of Health.
47 ClinicalTrials.gov (NCT03915184) Clinical Trial to Evaluate CT053 in Patients With Relapsed and/or Refractory Multiple Myeloma (LUMMICAR STUDY 2). U.S. National Institutes of Health.
48 Clinical pipeline report, company report or official report of CRISPR Therapeutics.
49 Clinical pipeline report, company report or official report of AbbVie.
50 ClinicalTrials.gov (NCT03711864) Safety and Efficacy of IM21 Car-t Cells in Patients With Recurrent or Refractory BCMA Positive Multiple Myeloma
51 ClinicalTrials.gov (NCT03318861) A Study Evaluating the Safety and Efficacy of KITE-585 in Subjects With Relapsed/Refractory Multiple Myeloma
52 ClinicalTrials.gov (NCT03674463) LCAR-B4822M-02 Cells in Treating Relapsed/Refractory (R/R) Multiple Myeloma
53 A novel BCMA PBD-ADC with ATM/ATR/WEE1 inhibitors or bortezomib induce synergistic lethality in multiple myeloma. Leukemia. 2020 Aug;34(8):2150-2162.
54 ClinicalTrials.gov (NCT03288493) P-BCMA-101 Tscm CAR-T Cells in the Treatment of Patients With Multiple Myeloma (MM)
55 Clinical pipeline report, company report or official report of Poseida Therapeutics.
56 ClinicalTrials.gov (NCT04318327) BCMA-directed CAR-T Cell Therapy in Adult Patients With Relapsed and/or Refractory Multiple Myeloma. U.S. National Institutes of Health.
57 Clinical pipeline report, company report or official report of Genentech.
58 Clinical pipeline report, company report or official report of Roche
59 ClinicalTrials.gov (NCT03582033) A Phase 1 Study of SEA-BCMA in Patients With Relapsed or Refractory Multiple Myeloma. U.S.National Institutes of Health.
60 Clinical pipeline report, company report or official report of AbbVie.
61 ClinicalTrials.gov (NCT04123418) A Study of WVT078 in Patients With Multiple Myeloma (MM). U.S. National Institutes of Health.
62 ClinicalTrials.gov (NCT03492268) Safety and Efficacy Evaluation of BCMA-CART for Treating Multiple Myeloma
63 ClinicalTrials.gov (NCT03752541) Efficacy and Safety Evaluation of BCMA-UCART
64 ClinicalTrials.gov (NCT03302403) Clinical Study of Redirected Autologous T Cells With a Chimeric Antigen Receptor in Patients With Malignant Tumors
65 ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma
66 Clinical pipeline report, company report or official report of Poseida Therapeutics.