Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZBRVL)

• DTT Name: Staphylococcus Enoyl ACP reductase (Stap-coc fabI)
• Synonyms: NADPHdependent enoylACP reductase; Enoyl[acylcarrierprotein] reductase [NADPH] FabI
• Gene Name: Stap-coc fabI
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Short-chain dehydrogenases reductase
• UniProt ID: FABI_STAA8
• TTD ID: T23036
• Sequence:
  MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
  HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
  SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
  DNIRVNAISASPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
  VTGENIHVDSGFHAIK
• Function: Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). It has a preference for a long chain (C12) substrate compared to the shorter (C4) acyl group. Involved in the elongation cycle of fatty acid which are used in the lipid metabolism.
• KEGG Pathway:
  Fatty acid biosynthesis (sao00061)
  Biotin metabolism (sao00780)
  Metabolic pathways (sao01100)
  Fatty acid metabolism (sao01212)

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Afabicin	DMFO2G5	Acute bacterial skin infection	1C41	Phase 2	[2]
AFN-1252	DMTFE9Y	Staphylococcus infection	1B5Y	Phase 2	[3]
CG-400549	DMFAKGR	Bacterial infection	1A00-1C4Z	Phase 2	[1]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MUT-056399	DMC3NSK	Methicillin-resistant staphylococci infection	1A00-1A09	Preclinical	[4]

References

• [1] In vitro activities of CG400549, a novel FabI inhibitor, against recently isolated clinical staphylococcal strains in Korea. Antimicrob Agents Chemother. 2007 Jul;51(7):2591-3.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Activity of AFN-1252, a novel FabI inhibitor, against Staphylococcus aureus in an in vitro pharmacodynamic model simulating human pharmacokinetics. J Chemother. 2013 Feb;25(1):32-5.
• [4] The MUT056399 inhibitor of FabI is a new antistaphylococcal compound. Antimicrob Agents Chemother. 2011 Oct;55(10):4692-7.