Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZYJ8U)

• DTT Name: Mycobacterium Antigen complex 85A (MycB fbpA)
• Synonyms: Fibronectinbinding protein A; Fbps A; Diacylglycerol acyltransferase/mycolyltransferase Ag85A; Antigen 85 complex A; Ag85A; AcylCoA:diacylglycerol acyltransferase; 85A
• Gene Name: MycB fbpA
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Acyltransferase
• UniProt ID: A85A_MYCTU
• TTD ID: T74203
• Sequence:
  MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS
  MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS
  FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI
  YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV
  GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
  DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
• Function: The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. It has a preference for C26:0-CoAover C18:1-CoA.
• KEGG Pathway:
  Glycerolipid metabolism (mtu00561)
  Metabolic pathways (mtu01100)
• BioCyc Pathway: MetaCyc:G185E-8100-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MVA-85A	DMKDN1C	Mycobacterium infection	1B10-1B21	Phase 2	[1]

References

• [1] MVA-85A, a novel candidate booster vaccine for the prevention of tuberculosis in children and adults. Curr Opin Mol Ther. 2010 Feb;12(1):124-34.