Target General Infomation
Target ID
T37539
Former ID
TTDS00480
Target Name
B-cell receptor CD22
Gene Name
CD22
Synonyms
B-lymphocyte cell adhesion molecule; BL-CAM; Leu-14; Sialic acid-binding Ig-like lectin 2; Siglec-2; CD22
Target Type
Successful
Disease Aggressive non-hodgkin's lymphoma [ICD9: 200, 201, 202, 202.8, 208.9; ICD10: C81, C81-C86, C82-C85, C91-C95]
Autoimmune diabetes [ICD10: E08-E13]
Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Hematological malignancies [ICD9: 200-209; ICD10: C81-C86]
Haematological malignancies [ICD9: 200-209; ICD10: C81-C86]
Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86]
Leukemia [ICD9: 208.9; ICD10: C90-C95]
Lyme disease [ICD9: 88.81; ICD10: A69.2]
Non-hodgkin's lymphoma; Diffuse large B-cell lymphoma [ICD9: 200, 200.0, 202; ICD10: C82-C85, C83.3]
Systemic lupus erythematosus; Graft rejection in heart transplantation [ICD9: 695, 710.0, 996; ICD10: L51-L54, M32, T86]
Function
Mediates b-cell b-cell interactions. May be involvedin the localization of b-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is cd45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can bemasked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of b-cell antigen receptor signaling. Plays a role in positive regulation through interaction with src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their sh2 domains that block signal transduction through dephosphorylation of signaling molecules.
BioChemical Class
Immunoglobulin
Target Validation
T37539
UniProt ID
Sequence
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT
TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES
SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
Drugs and Mode of Action
Drug(s) Inotuzumab ozogamicin Drug Info Approved Acute lymphoblastic leukemia [543021], [547545]
OspA lipoprotein Drug Info Approved Lyme disease [536381]
Epratuzumab Drug Info Phase 3 Systemic lupus erythematosus; Graft rejection in heart transplantation [537129], [542963]
BL-22 Drug Info Phase 2 Acute lymphoblastic leukemia [522698]
Anti-CD22 Drug Info Phase 1 Hematologic malignancies [551667]
Combotox Drug Info Phase 1 Leukemia [548715]
Moxetumomab pasudotox Drug Info Phase 1 Haematological malignancies [551581]
Targeted ranpirnase conjugates Drug Info Preclinical Cancer [548045]
DCDT-2980S Drug Info Discontinued in Phase 2 Non-hodgkin's lymphoma; Diffuse large B-cell lymphoma [548683]
RG7593 Drug Info Discontinued in Phase 2 Hematological malignancies [548683]
Modulator Anti-CD22/CD19 mab-toxin conjugate Drug Info [525761]
Combotox Drug Info
Moxetumomab pasudotox Drug Info [531663]
RG7593 Drug Info [551601]
Binder OspA lipoprotein Drug Info [534840]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
B cell receptor signaling pathway
PANTHER Pathway B cell activation
Pathway Interaction Database BCR signaling pathway
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
WikiPathways B Cell Receptor Signaling Pathway
References
Ref 522698ClinicalTrials.gov (NCT00924040) Retreatment Protocol for BL22 Immunotherapy in Relapsed or Refractory Hairy Cell Leukemia. U.S. National Institutes of Health.
Ref 536381Infection of mice with lyme disease spirochetes constitutively producing outer surface proteins a and B. Infect Immun. 2007 Jun;75(6):2786-94. Epub 2007 Mar 19.
Ref 537129New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
Ref 542963(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8088).
Ref 543021(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8266).
Ref 547545Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017171)
Ref 548045Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021480)
Ref 548683Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027651)
Ref 548715Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936)
Ref 551581Advances in the Development of Anti-CD22 Immunotoxins Containing Pseudomonas Exotoxin for Treatment of Hematologic Malignancies
Ref 5516672011 Pipeline of Seattle Genetics.
Ref 525761Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8.
Ref 530776Anti-CD22 immunotoxin RFB4(dsFv)-PE38 (BL22) for CD22-positive hematologic malignancies of childhood: preclinical studies and phase I clinical trial. Clin Cancer Res. 2010 Mar 15;16(6):1894-903.
Ref 531663Antibody fusion proteins: anti-CD22 recombinant immunotoxin moxetumomab pasudotox. Clin Cancer Res. 2011 Oct 15;17(20):6398-405.
Ref 532335Results of inotuzumab ozogamicin, a CD22 monoclonal antibody, in refractory and relapsed acute lymphocytic leukemia. Cancer. 2013 Aug 1;119(15):2728-36.
Ref 534840Safety and immunogenicity of recombinant Bacille Calmette-Gu?|rin (rBCG) expressing Borrelia burgdorferi outer surface protein A (OspA) lipoprotein in adult volunteers: a candidate Lyme disease vaccine. Vaccine. 1999 Feb 26;17(7-8):904-14.
Ref 537129New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
Ref 543710(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2786).
Ref 544284Efficacy and toxicity of a CD22-targeted antibody-saporin conjugate in a xenograft model of non-Hodgkin's lymphoma. Oncoimmunology. 2012 December 1; 1(9): 1469-1475.
Ref 550223Clinical pipeline report, company report or official report of Alfacell.
Ref 551601Clinical pipeline report, company report or official report of Roche.
Ref 5516672011 Pipeline of Seattle Genetics.