Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T05114
|
||||
| Former ID |
TTDR00197
|
||||
| Target Name |
Chymase
|
||||
| Gene Name |
CMA1
|
||||
| Synonyms |
Mast cell protease I; CMA1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma; Chronic obstructive pulmonary disease [ICD9: 490-492, 493, 494-496; ICD10: J40-J44, J47, J45] | ||||
| Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
| Heart failure [ICD9: 428; ICD10: I50] | |||||
| Function |
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T05114
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.39
|
||||
| Sequence |
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI NQILQAN |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 2-(N-Morpholino)-Ethanesulfonic Acid | Drug Info | [551393] | ||
| BAY 11-42524 | Drug Info | [525207] | |||
| BCEAB | Drug Info | [535651] | |||
| Benzylsulfinic Acid | Drug Info | [551374] | |||
| CHYMOSTATIN | Drug Info | [528779] | |||
| JNJ-10311795 | Drug Info | [528733] | |||
| KM-01221 | Drug Info | [543597] | |||
| NK3201 | Drug Info | [535865] | |||
| Phenylalanylmethane | Drug Info | [551393] | |||
| Rac-2q | Drug Info | [528779] | |||
| SUN-C8257 | Drug Info | [535508] | |||
| Y-40613 | Drug Info | [535652] | |||
| Modulator | ASB17061 | Drug Info | [532439] | ||
| SUN13834 | Drug Info | ||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 524171 | ClinicalTrials.gov (NCT01756898) A Study to Evaluate the Efficacy, Safety and Pharmacokinetics of ASB17061 Capsules in Adult Subjects With Atopic Dermatitis. U.S. National Institutes of Health. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 525207 | ClinicalTrials.gov (NCT02452515) A Single-blind Pilot Study to Investigate Safety and Tolerability of the Chymase Inhibitor BAY1142524 in Clinically Stable Patients With Left-ventricular Dysfunction. | ||||
| Ref 528733 | J Med Chem. 2007 Apr 19;50(8):1727-30. Epub 2007 Mar 16.Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase. | ||||
| Ref 528779 | Bioorg Med Chem Lett. 2007 Jun 15;17(12):3431-4. Epub 2007 Mar 16.Identification of 6-substituted 4-arylsulfonyl-1,4-diazepane-2,5-diones as a novel scaffold for human chymase inhibitors. | ||||
| Ref 532439 | Immunology of atopic eczema: overcoming the Th1/Th2 paradigm. Allergy. 2013 Aug;68(8):974-82. | ||||
| Ref 535508 | Chymase inhibitor ameliorates eosinophilia in mice infected with Nippostrongylus brasiliensis. Int Arch Allergy Immunol. 2002 Jul;128(3):235-9. | ||||
| Ref 535651 | Development of a chymase inhibitor: pharmacological characterization of a chymase inhibitor in inflamed tissue remodeling and fibrosis. Jpn J Pharmacol. 2002 Nov;90(3):206-9. | ||||
| Ref 535652 | Therapeutic potential of a specific chymase inhibitor in atopic dermatitis. Jpn J Pharmacol. 2002 Nov;90(3):214-7. | ||||
| Ref 535865 | Impact of chymase inhibitor on cardiac function and survival after myocardial infarction. Cardiovasc Res. 2003 Nov 1;60(2):413-20. | ||||
