Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T86674
|
||||
| Former ID |
TTDC00002
|
||||
| Target Name |
Hemagglutinin
|
||||
| Gene Name |
HA
|
||||
| Synonyms |
Hemagglutinin HA1 chain; Hemagglutinin HA2 chain; HA
|
||||
| Target Type |
Successful
|
||||
| Disease | Infections disease [ICD10: A00-B99] | ||||
| Influenza virus [ICD10: J11.1] | |||||
| Influenza A virus H5N1 [ICD9: 487, 488; ICD10: J10, J11] | |||||
| Viral infections [ICD9: 054.0, 054.1, 054.2, 054.3, 075, 771.2, 052, 053; ICD10: B01, B02, A60, B00, B27, G05.1, P35.2] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin- independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
|
||||
| BioChemical Class |
Influenza viruses hemagglutinin
|
||||
| Target Validation |
T86674
|
||||
| UniProt ID | |||||
| Sequence |
MKTIIALSYIFCLALGQDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQ
SSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPD YASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVL NVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVR GLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITP NGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWE GMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEG RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGN GCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISC FLLCVVLLGFIMWACQRGNIRCNICI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Arbidol | Drug Info | Approved | Viral infections | [551871] |
| CR8020 mab | Drug Info | Phase 2 | Influenza virus | [524539] | |
| RG7745 | Drug Info | Phase 2 | Infections disease | [549487] | |
| A/Anhui/05 | Drug Info | Phase 1 | Influenza virus | [522683] | |
| ND-1.1 | Drug Info | Phase 1 | Influenza virus | [524082] | |
| VGX-3400 | Drug Info | Phase 1 | Influenza A virus H5N1 | [523072] | |
| Inhibitor | 2-tert-butylbenzene-1,4-diol | Drug Info | [551374] | ||
| Alpha-D-Mannose | Drug Info | [551393] | |||
| Arbidol | Drug Info | [537138], [537338] | |||
| BMY-27709 | Drug Info | [535252], [535454], [536931], [538146] | |||
| CL 385319 | Drug Info | [535252], [535454], [536931], [538146] | |||
| Stachyflin | Drug Info | [535252], [535454], [536931], [538146] | |||
| TBHQ | Drug Info | [535252], [535454], [536931], [538146] | |||
| Modulator | PXVX-0103 | Drug Info | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| DRM | DRM Info | ||||
| References | |||||
| Ref 522683 | ClinicalTrials.gov (NCT00912496) Booster Trial to 07-0019 With A/Anhui/05 With and Without MF59. U.S. National Institutes of Health. | ||||
| Ref 523072 | ClinicalTrials.gov (NCT01142362) Study of VGX-3400X, H5N1 Avian Influenza Virus DNA Plasmid + Electroporation in Healthy Adults. U.S. National Institutes of Health. | ||||
| Ref 524082 | ClinicalTrials.gov (NCT01698060) Immunogenicity of ND1.1 by Delivery Directly to the Ileum. U.S. National Institutes of Health. | ||||
| Ref 524539 | ClinicalTrials.gov (NCT01992276) Assessment of Efficacy of CR8020 and CR6261, Monoclonal Antibodies, Against Influenza Infection. U.S. National Institutes of Health. | ||||
| Ref 532121 | An adenovirus-based vaccine with a double-stranded RNA adjuvant protects mice and ferrets against H5N1 avian influenza in oral delivery models. Clin Vaccine Immunol. 2013 Jan;20(1):85-94. | ||||
| Ref 532953 | Characterization of a broadly neutralizing monoclonal antibody that targets the fusion domain of group 2 influenza A virus hemagglutinin. J Virol. 2014 Dec;88(23):13580-92. | ||||
| Ref 535252 | An approach to the identification of potent inhibitors of influenza virus fusion using parallel synthesis methodology. Bioorg Med Chem Lett. 2001 Sep 3;11(17):2393-6. | ||||
| Ref 535454 | Novel stachyflin derivatives from Stachybotrys sp. RF-7260. Fermentation, isolation, structure elucidation and biological activities. J Antibiot (Tokyo). 2002 Mar;55(3):239-48. | ||||
| Ref 536931 | Structure of influenza hemagglutinin in complex with an inhibitor of membrane fusion. Proc Natl Acad Sci U S A. 2008 Nov 18;105(46):17736-41. Epub 2008 Nov 12. | ||||
| Ref 537138 | Investigation of triazavirin antiviral activity against influenza A virus (H5N1) in cell culture. Antibiot Khimioter. 2007;52(11-12):18-20. | ||||
| Ref 537338 | Pharmacokinetic properties and bioequivalence of two formulations of arbidol: an open-label, single-dose, randomized-sequence, two-period crossover study in healthy Chinese male volunteers. Clin Ther. 2009 Apr;31(4):784-92. | ||||
| Ref 538146 | Inhibition of influenza A virus replication by compounds interfering with the fusogenic function of the viral hemagglutinin. J Virol. 1999 Jan;73(1):140-51. | ||||
