Target General Infomation
Target ID
T31621
Former ID
TTDR00567
Target Name
Heparin-binding growth factor 2
Gene Name
FGF2
Synonyms
BFGF; Basic fibroblast growth factor; FGF-2; Fibroblast growth factor 2; HBGF-2; Prostatropin; FGF2
Target Type
Successful
Disease Arteriosclerosis [ICD9: 440; ICD10: I70]
Acne vulgaris [ICD9: 706.1; ICD10: L70.0]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Diabetic retinopathy [ICD9: 250.5; ICD10: H36, E10.3, E11.3, E13.3]
Multiple myeloma [ICD9: 203; ICD10: C90]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Function
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
BioChemical Class
Heparin-binding growth factors family
UniProt ID
Sequence
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Structure
1BAS; 1BFB; 1BFC; 1BFF; 1BFG; 1BLA; 1BLD; 1CVS; 1EV2; 1FGA; 1FQ9; 1II4; 1IIL; 2BFH; 2FGF; 2M49; 4FGF; 4OEE; 4OEF; 4OEG
Drugs and Mode of Action
Drug(s) Sucralfate Drug Info Approved Acne vulgaris [523336], [542066], [551871]
Squalamine Drug Info Phase 3 Cancer [521667]
DVC1-0101 Drug Info Phase 2 Arteriosclerosis [532195]
TGP-580 Drug Info Discontinued in Phase 2 Neurodegenerative disease [545028]
RG-8803 Drug Info Terminated Diabetic retinopathy [546922]
Inhibitor 1,4-Dideoxy-5-Dehydro-O2-Sulfo-Glucuronic Acid Drug Info [551393]
1,4-Dideoxy-O2-Sulfo-Glucuronic Acid Drug Info [551393]
Beta-Mercaptoethanol Drug Info [551393]
BIBF100 Drug Info [537114]
N,O6-Disulfo-Glucosamine Drug Info [551393]
RG-8803 Drug Info [551906]
Modulator DVC1-0101 Drug Info [532195]
Squalamine Drug Info [551462]
Sucralfate Drug Info [533712], [551871]
TGP-580 Drug Info [525608]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
NetPath Pathway IL1 Signaling Pathway
Pathway Interaction Database Glypican 1 network
Angiopoietin receptor Tie2-mediated signaling
Integrins in angiogenesis
Syndecan-4-mediated signaling events
FGF signaling pathway
Reactome PI3K Cascade
PIP3 activates AKT signaling
FGFR4 ligand binding and activation
FGFR3c ligand binding and activation
FGFR2c ligand binding and activation
FGFR2b ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Syndecan interactions
Non-integrin membrane-ECM interactions
FGFR1
Phospholipase C-mediated cascade
Phospholipase C-mediated cascade
Phospholipase C-mediated cascade
FGFR1
FGFR1
FRS-mediated FGFR1 signaling
FGFR2
FGFR2
FRS-mediated FGFR2 signaling
FGFR3
FRS-mediated FGFR3 signaling
FGFR3
FRS-mediated FGFR4 signaling
FGFR4
FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
WikiPathways Regulation of Actin Cytoskeleton
Endochondral Ossification
Differentiation Pathway
Cardiac Hypertrophic Response
Syndecan interactions
Extracellular matrix organization
Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
PIP3 activates AKT signaling
Cardiac Progenitor Differentiation
Integrated Pancreatic Cancer Pathway
Neural Crest Differentiation
miR-targeted genes in squamous cell - TarBase
miR-targeted genes in muscle cell - TarBase
miR-targeted genes in lymphocytes - TarBase
Signaling by FGFR
MicroRNAs in cardiomyocyte hypertrophy
Angiogenesis
References
Ref 521667ClinicalTrials.gov (NCT00139282) A Safety and Efficacy Study of Squalamine Lactate for Injection (MSI-1256F) for "Wet" Age-Related Macular Degeneration. U.S. National Institutes of Health.
Ref 523336ClinicalTrials.gov (NCT01284647) A Study to Evaluate the Efficacy of Teprenone On Chinese Patients With Chronic Non-Atrophic Erosive Gastritis. U.S. National Institutes of Health.
Ref 532195DVC1-0101 to treat peripheral arterial disease: a Phase I/IIa open-label dose-escalation clinical trial. Mol Ther. 2013 Mar;21(3):707-14.
Ref 542066(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7055).
Ref 545028Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001922)
Ref 546922Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011158)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525608Expression of fibroblast growth factor-2 transcripts in the healing of acetic acid-induced gastric ulcers. APMIS. 1999 Aug;107(8):767-72.
Ref 532195DVC1-0101 to treat peripheral arterial disease: a Phase I/IIa open-label dose-escalation clinical trial. Mol Ther. 2013 Mar;21(3):707-14.
Ref 533712Assessment of sucralfate coating by sequential scintigraphic imaging in radiation-induced esophageal lesions. Gastrointest Endosc. 1995 Feb;41(2):109-14.
Ref 537114Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551462Clinical pipeline report, company report or official report of Ohr Pharmaceutical.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551906US patent application no. 2010,0278,784, Methods and compositions for treating skin conditions.