Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T79232
|
||||
| Former ID |
TTDS00109
|
||||
| Target Name |
Vasopressin V1a receptor
|
||||
| Gene Name |
AVPR1A
|
||||
| Synonyms |
AVPR V1a; Antidiuretic hormone receptor 1a; V1a vasopressin receptor; V1aR; Vascular/hepatic-type arginine vasopressin receptor; AVPR1A
|
||||
| Target Type |
Successful
|
||||
| Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
| Acute and chronic heart failure [ICD9: 428; ICD10: I50] | |||||
| Autism [ICD9: 299; ICD10: F84.0] | |||||
| Cardiotonic [ICD10: I50] | |||||
| Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6] | |||||
| Euvolemic hyponatremia [ICD9: 276.1; ICD10: E87.1] | |||||
| Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
| Hyponatraemia [ICD10: E87.1] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Infertility [ICD9: 628; ICD10: N97.0] | |||||
| Localisation [ICD code not available] | |||||
| Septic shock [ICD9: 785.52; ICD10: A41.9] | |||||
| Function |
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T79232
|
||||
| UniProt ID | |||||
| Sequence |
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Conivaptan | Drug Info | Approved | Euvolemic hyponatremia | [537060], [539403] |
| Felypressin | Drug Info | Approved | Localisation | [544498] | |
| Mozavaptan | Drug Info | Approved | Hyponatraemia | [539396], [544970], [551871] | |
| OPC-31260 | Drug Info | Approved | Hyponatraemia | [544970], [551871] | |
| Terlipressin | Drug Info | Approved | Hypertension | [536973] | |
| ATOSIBAN | Drug Info | Phase 4 | Discovery agent | [524034], [539407] | |
| FE-202158 | Drug Info | Phase 2 | Septic shock | [523936] | |
| RG7314 | Drug Info | Phase 2 | Autism | [524213] | |
| VA-111913 | Drug Info | Phase 2 | Dysmenorrhea | [522765] | |
| SRX-246 | Drug Info | Phase 1/2 | Anxiety disorder | [548241] | |
| SRX-251 | Drug Info | Phase 1 | Dysmenorrhea | [548381] | |
| NOX-F37 | Drug Info | Preclinical | Acute and chronic heart failure | [536372] | |
| OPC-21268 | Drug Info | Discontinued in Phase 2 | Cardiotonic | [539395], [544608] | |
| Relcovaptan | Drug Info | Discontinued in Phase 2 | Discovery agent | [539400], [545828] | |
| PF-3274167 | Drug Info | Discontinued in Phase 1 | Female sexual dysfunction | [548448] | |
| JTV-605 | Drug Info | Terminated | Dysmenorrhea | [546818] | |
| L-371257 | Drug Info | Terminated | Discovery agent | [539425], [546463] | |
| Inhibitor | 1'-tosylspiro[indene-1,4'-piperidine] | Drug Info | [530975] | ||
| A-987306 | Drug Info | [529789] | |||
| Ac-Phe-[Orn-Pro-cha-Trp-Arg] | Drug Info | [528343] | |||
| ARGENINE VASOPRESSIN | Drug Info | [528674] | |||
| ATOSIBAN | Drug Info | [529164] | |||
| D(CH2)5[Tyr(Me)2,Thr4,Orn8(5/6C-Flu),Tyr-NH29]VT | Drug Info | [526347] | |||
| D(CH2)5[Tyr(Me)2,Thr4,Orn8,Tyr9-NH2]VT | Drug Info | [526347] | |||
| DesGly-NH2,d(CH2)5[D-Tyr2,Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| DVDAVP | Drug Info | [528674] | |||
| D[Arg4,Dab8]VP | Drug Info | [528674] | |||
| D[Arg4,Lys8]VP | Drug Info | [528674] | |||
| D[Arg4,Orn8]VP | Drug Info | [528674] | |||
| D[Arg4]AVP | Drug Info | [528674] | |||
| D[Cha4,Dab8]VP | Drug Info | [528674] | |||
| D[Cha4,Dap8]VP | Drug Info | [528674] | |||
| D[Cha4,Lys8]VP | Drug Info | [528674] | |||
| D[Cha4,Orn8]VP | Drug Info | [528674] | |||
| D[Cha4]AVP | Drug Info | [528674] | |||
| D[D-3-Pal2]AVP | Drug Info | [528674] | |||
| D[Leu4,Dab8]VP | Drug Info | [528674] | |||
| D[Leu4,Dap8]VP | Drug Info | [528674] | |||
| D[Leu4,Lys8]VP | Drug Info | [528674] | |||
| D[Leu4,Orn8]VP | Drug Info | [528674] | |||
| D[Leu4]AVP | Drug Info | [528674] | |||
| D[Lys8(5/6-Flu)]VT | Drug Info | [526347] | |||
| D[Orn4,Lys8]VP | Drug Info | [528674] | |||
| D[Orn4,Orn8]VP | Drug Info | [528674] | |||
| D[Orn4]AVP | Drug Info | [528674] | |||
| D[Orn8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| D[Thr4,Lys8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| D[Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| D[Val4]AVP | Drug Info | [528674] | |||
| HO-LVA | Drug Info | [529036] | |||
| Hoo-Phe-Orn-Pro-hle-Pff-Phe-NH2 | Drug Info | [528343] | |||
| L-371257 | Drug Info | [530975] | |||
| L-372662 | Drug Info | [530975] | |||
| Mozavaptan | Drug Info | [533576] | |||
| PF-3274167 | Drug Info | [530975] | |||
| Relcovaptan | Drug Info | [529036] | |||
| SR-149415 | Drug Info | [530420] | |||
| [HO1][Lys8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| [HO1][Orn8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| [HO1][Orn8(5/6C-Rhm)]VT | Drug Info | [526347] | |||
| [HO1][Thr4,Lys8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| [HO1][Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [526347] | |||
| [Lys8(Alexa 488) ]PVA | Drug Info | [529036] | |||
| [Lys8(Alexa 546) ]PVA | Drug Info | [529036] | |||
| Antagonist | CL-385004 | Drug Info | [535608] | ||
| d(CH2)5[Tyr(Me)2]AVP | Drug Info | [525804] | |||
| d[Pen1,Tyr(Me)2]AVP | Drug Info | [534813] | |||
| JTV-605 | Drug Info | [535608] | |||
| L023103 | Drug Info | [527891] | |||
| LS-192629 | Drug Info | [526585] | |||
| NOX-F37 | Drug Info | [536372] | |||
| OPC-21268 | Drug Info | [534873], [535608] | |||
| OPC-31260 | Drug Info | [534873] | |||
| SRX-246 | Drug Info | [532259] | |||
| SRX-251 | Drug Info | [528051] | |||
| SSR126768A | Drug Info | [526928] | |||
| V1A F/U | Drug Info | [543796] | |||
| VA-111913 | Drug Info | [550311] | |||
| YM 218 | Drug Info | [527388] | |||
| YM 471 | Drug Info | [526095] | |||
| [3H]relcovaptan | Drug Info | [533909] | |||
| Modulator | Conivaptan | Drug Info | [526189], [529082] | ||
| RG7314 | Drug Info | [544372] | |||
| Agonist | dAVP | Drug Info | [527042] | ||
| FE-202158 | Drug Info | [532722] | |||
| Felypressin | Drug Info | [536790] | |||
| [3H]OT (human, mouse, rat) | Drug Info | [534487] | |||
| [Phe3]OT | Drug Info | [533733] | |||
| [Thr4,Gly7]OT | Drug Info | [534487] | |||
| [Val4]AVP | Drug Info | [526466] | |||
| Stimulator | Terlipressin | Drug Info | [537593] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Vascular smooth muscle contraction | |||||
| Reactome | Vasopressin-like receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 522765 | ClinicalTrials.gov (NCT00963053) VA111913 Dysmenorrhoea Efficacy and Safety Proof of Concept. U.S. National Institutes of Health. | ||||
| Ref 523936 | ClinicalTrials.gov (NCT01612676) Investigating FE 202158 as Potential Primary Treatment in Patients With Early Septic Shock. U.S. National Institutes of Health. | ||||
| Ref 524034 | ClinicalTrials.gov (NCT01673399) Oxytocin Antagonist in Patients With Repeated Failure of Implantation. U.S. National Institutes of Health. | ||||
| Ref 524213 | ClinicalTrials.gov (NCT01793441) A Study of RG7314 to Investigate Efficacy and Safety in Individuals With Autism Spectrum Disorders. U.S. National Institutes of Health. | ||||
| Ref 536372 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | ||||
| Ref 536973 | Pharmacology, clinical efficacy and safety of terlipressin in esophageal varices bleeding, septic shock and hepatorenal syndrome. Expert Rev Gastroenterol Hepatol. 2007 Dec;1(2):207-17. | ||||
| Ref 537060 | Emerging diuretics for the treatment of heart failure. Expert Opin Emerg Drugs. 2009 Mar;14(1):195-204. | ||||
| Ref 539395 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2196). | ||||
| Ref 539396 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2197). | ||||
| Ref 539400 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2200). | ||||
| Ref 539403 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2203). | ||||
| Ref 539407 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2213). | ||||
| Ref 539425 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2252). | ||||
| Ref 544608 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000284) | ||||
| Ref 544970 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001739) | ||||
| Ref 545828 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004942) | ||||
| Ref 546463 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008273) | ||||
| Ref 546818 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010443) | ||||
| Ref 548241 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023656) | ||||
| Ref 548381 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025117) | ||||
| Ref 525804 | Conserved aromatic residues in the transmembrane region VI of the V1a vasopressin receptor differentiate agonist vs. antagonist ligand binding. Eur J Biochem. 2000 Jul;267(13):4253-63. | ||||
| Ref 526095 | Effects of YM471, a nonpeptide AVP V(1A) and V(2) receptor antagonist, on human AVP receptor subtypes expressed in CHO cells and oxytocin receptors in human uterine smooth muscle cells. Br J Pharmacol. 2001 Jul;133(5):746-54. | ||||
| Ref 526189 | Acute hemodynamic effects of conivaptan, a dual V(1A) and V(2) vasopressin receptor antagonist, in patients with advanced heart failure. Circulation. 2001 Nov 13;104(20):2417-23. | ||||
| Ref 526347 | J Med Chem. 2002 Jun 6;45(12):2579-88.Synthesis and characterization of fluorescent antagonists and agonists for human oxytocin and vasopressin V(1)(a) receptors. | ||||
| Ref 526466 | [1-deamino-4-cyclohexylalanine] arginine vasopressin: a potent and specific agonist for vasopressin V1b receptors. Endocrinology. 2002 Dec;143(12):4655-64. | ||||
| Ref 526585 | Pharmacology of (2S,4Z)-N-[(2S)-2-hydroxy-2-phenylethyl]-4-(methoxyimino) -1-[(2'-methyl[1,1'-biphenyl]-4-yl)carbonyl]-2-pyrrolidinecarboxamide, a new potent and selective nonpeptide antagonist of the oxytocin receptor. J Pharmacol Exp Ther. 2003 Jul;306(1):253-61. Epub 2003 Mar 26. | ||||
| Ref 526928 | SSR126768A (4-chloro-3-[(3R)-(+)-5-chloro-1-(2,4-dimethoxybenzyl)-3-methyl-2-oxo-2,3-dihydro-1H-indol-3-yl]-N-ethyl-N-(3-pyridylmethyl)-benzamide, hydrochloride): a new selective and orally active oxytocin receptor antagonist for the prevention of preterm labor. J Pharmacol Exp Ther. 2004 Apr;309(1):414-24. Epub 2004 Jan 13. | ||||
| Ref 527042 | Design of potent and selective agonists for the human vasopressin V1b receptor based on modifications of [deamino-cys1]arginine vasopressin at position 4. J Med Chem. 2004 Apr 22;47(9):2375-88. | ||||
| Ref 527388 | Effects of YM218, a nonpeptide vasopressin V1A receptor-selective antagonist, on human vasopressin and oxytocin receptors. Pharmacol Res. 2005 Mar;51(3):275-81. | ||||
| Ref 527891 | Discovery and development of a new class of potent, selective, orally active oxytocin receptor antagonists. J Med Chem. 2005 Dec 1;48(24):7882-905. | ||||
| Ref 528051 | Orally active vasopressin V1a receptor antagonist, SRX251, selectively blocks aggressive behavior. Pharmacol Biochem Behav. 2006 Feb;83(2):169-74. Epub 2006 Feb 28. | ||||
| Ref 528343 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92. Epub 2006 Jul 28.Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivoactivity. | ||||
| Ref 528674 | J Med Chem. 2007 Feb 22;50(4):835-47.Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasopressin at positions 4 and 8. | ||||
| Ref 529036 | J Med Chem. 2007 Oct 4;50(20):4976-85. Epub 2007 Sep 12.Toward efficient drug screening by homogeneous assays based on the development of new fluorescent vasopressin and oxytocin receptor ligands. | ||||
| Ref 529082 | Conivaptan: a dual vasopressin receptor v1a/v2 antagonist [corrected]. Cardiovasc Drug Rev. 2007 Fall;25(3):261-79. | ||||
| Ref 529164 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):90-4. Epub 2007 Nov 6.The discovery of GSK221149A: a potent and selective oxytocin antagonist. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 530420 | Bioorg Med Chem Lett. 2009 Nov 1;19(21):6018-22. Epub 2009 Sep 17.Tetrahydroquinoline sulfonamides as vasopressin 1b receptor antagonists. | ||||
| Ref 532259 | Pharmacokinetics and metabolism of SRX246: a potent and selective vasopressin 1a antagonist. J Pharm Sci. 2013 Jun;102(6):2033-43. | ||||
| Ref 532722 | The selective vasopressin type 1a receptor agonist selepressin (FE 202158) blocks vascular leak in ovine severe sepsis*. Crit Care Med. 2014 Jul;42(7):e525-33. | ||||
| Ref 533733 | Tyr115 is the key residue for determining agonist selectivity in the V1a vasopressin receptor. EMBO J. 1995 May 15;14(10):2176-82. | ||||
| Ref 533909 | Binding of [3H] SR 49059, a potent nonpeptide vasopressin V1a antagonist, to rat and human liver membranes. Biochem Biophys Res Commun. 1994 Feb 28;199(1):353-60. | ||||
| Ref 534487 | Mapping peptide-binding domains of the human V1a vasopressin receptor with a photoactivatable linear peptide antagonist. J Biol Chem. 1997 Oct 17;272(42):26536-44. | ||||
| Ref 534813 | Pharmacological characterization of the human vasopressin receptor subtypes stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1998 Dec;125(7):1463-70. | ||||
| Ref 534873 | Nonpeptide vasopressin antagonists: a new group of hormone blockers entering the scene. Exp Clin Endocrinol Diabetes. 1999;107(3):157-65. | ||||
| Ref 535608 | Nonpeptide vasopressin receptor antagonists: development of selective and orally active V1a, V2 and V1b receptor ligands. Prog Brain Res. 2002;139:197-210. | ||||
| Ref 536372 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | ||||
| Ref 536790 | Peptide and non-peptide agonists and antagonists for the vasopressin and oxytocin V1a, V1b, V2 and OT receptors: research tools and potential therapeutic agents. Prog Brain Res. 2008;170:473-512. | ||||
| Ref 537593 | Investigational vasopressin receptor modulators in the pipeline. Expert Opin Investig Drugs. 2009 Aug;18(8):1119-31. | ||||
| Ref 543796 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 366). | ||||
