Target General Infomation
Target ID
T36121
Former ID
TTDC00271
Target Name
Myc proto-oncogene protein
Gene Name
MYC
Synonyms
C-myc; C-myc oncogene; MYC
Target Type
Research
Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'- CAC[GA]TG-3'. Activates the transcription of growth-related genes.
Target Validation
T36121
UniProt ID
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA
Inhibitor TWS-119 Drug Info [527964]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
ErbB signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Thyroid hormone signaling pathway
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Thyroid cancer
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Central carbon metabolism in cancer
NetPath Pathway IL9 Signaling Pathway
TCR Signaling Pathway
IL2 Signaling Pathway
IL4 Signaling Pathway
EGFR1 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
Notch Signaling Pathway
Wnt Signaling Pathway
TSH Signaling Pathway
PANTHER Pathway Interleukin signaling pathway
Oxidative stress response
PDGF signaling pathway
Wnt signaling pathway
p53 pathway feedback loops 2
CCKR signaling map ST
Pathway Interaction Database Regulation of nuclear SMAD2/3 signaling
Notch signaling pathway
p73 transcription factor network
E2F transcription factor network
CD40/CD40L signaling
Validated targets of C-MYC transcriptional activation
Presenilin action in Notch and Wnt signaling
LKB1 signaling events
Regulation of Telomerase
IL2-mediated signaling events
C-MYC pathway
IL2 signaling events mediated by PI3K
Ceramide signaling pathway
AP-1 transcription factor network
FOXM1 transcription factor network
IL6-mediated signaling events
PDGFR-beta signaling pathway
C-MYB transcription factor network
Validated nuclear estrogen receptor alpha network
Regulation of nuclear beta catenin signaling and target gene transcription
IL2 signaling events mediated by STAT5
Validated targets of C-MYC transcriptional repression
Reactome NOTCH1 Intracellular Domain Regulates Transcription
SMAD4 heterotrimer regulates transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
CTNNB1 to target gene promoters
MAPK6/MAPK4 signaling
Cyclin E associated events during G1/S transition
Cdk2-associated events at S phase entry
WikiPathways DNA Damage Response (only ATM dependent)
DNA Damage Response
ErbB Signaling Pathway
Notch Signaling Pathway
IL-2 Signaling Pathway
G1 to S cell cycle control
Wnt Signaling Pathway
p38 MAPK Signaling Pathway
Wnt Signaling Pathway and Pluripotency
MAPK Signaling Pathway
TGF beta Signaling Pathway
Wnt Signaling Pathway Netpath
PPAR Alpha Pathway
Ectoderm Differentiation
Organogenesis (Part 2 of 3)
Bladder Cancer
Mammary gland development pathway - Involution (Stage 4 of 4)
Induction (Part 1 of 3)
S Phase
SMAD4 heterotrimer
Signaling by NOTCH1
Structural Pathway of Interleukin 1 (IL-1)
Aryl Hydrocarbon Receptor
Polycystic Kidney Disease Pathway
Apoptosis
Retinoblastoma (RB) in Cancer
Spinal Cord Injury
Integrated Pancreatic Cancer Pathway
Gastric cancer network 2
B Cell Receptor Signaling Pathway
Prostate Cancer
Metastatic brain tumor
TSLP Signaling Pathway
Neural Crest Differentiation
IL-7 Signaling Pathway
TSH signaling pathway
Integrated Breast Cancer Pathway
Integrated Cancer pathway
Mitotic G1-G1/S phases
TP53 Network
miRNAs involved in DNA damage response
miRNA Regulation of DNA Damage Response
IL-5 Signaling Pathway
References
Ref 527964Nat Chem Biol. 2005 Jul;1(2):74-84.Diversity-oriented synthesis: exploring the intersections between chemistry and biology.