Target General Infomation
Target ID
T16601
Former ID
TTDR00681
Target Name
Carcinoembryonic antigen-related cell adhesion molecule 5
Gene Name
CEACAM5
Synonyms
CD66e antigen; CEA; Carcinoembryonic antigen; Meconium antigen 100; CEACAM5
Target Type
Clinical Trial
Disease Breast cancer [ICD9: 174, 175; ICD10: C50]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Glioblastoma multiforme [ICD9: 191; ICD10: C71]
Metastatic medullary thyroid cancer [ICD9: 193; ICD10: C73]
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Small-cell lung cancer [ICD9: 162.9; ICD10: C33-C34]
Function
Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins.
BioChemical Class
Immunoglobulin
UniProt ID
Sequence
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Drugs and Mode of Action
Drug(s) CAP1-6D Drug Info Phase 2 Pancreatic cancer [521707]
CeaVac Drug Info Phase 2 Colorectal cancer [521450]
DNA fusion vaccine Drug Info Phase 2 Cancer [549707]
IDM-2101 Drug Info Phase 2 Colorectal cancer [529705]
Labetuzumab I-131 Drug Info Phase 2 Colorectal cancer [527751]
Pentacea Drug Info Phase 2 Small-cell lung cancer [547157]
AVX701 Drug Info Phase 1/2 Colorectal cancer [522116]
CT84.66 Drug Info Phase 1/2 Breast cancer [522271]
SAR408701 Drug Info Phase 1/2 Solid tumours [524831]
123-Iodine-labeled MFE-23 Drug Info Phase 1 Cancer [530224]
CIGB-M3 Drug Info Phase 1 Colorectal cancer [531534]
GI-6207 Drug Info Phase 1 Metastatic medullary thyroid cancer [524297]
MV-CEA Drug Info Phase 1 Glioblastoma multiforme [530664]
RG7813 Drug Info Phase 1 Solid tumours [549518]
KSB-303 Drug Info Discontinued in Phase 1/2 Colorectal cancer [546628]
Modulator AVX701 Drug Info [531637]
CAP1-6D Drug Info [530852], [534511]
GI-6207 Drug Info [551895]
MV-CEA Drug Info [530664]
Inhibitor RG7813 Drug Info [531635], [551608]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
NetPath Pathway TGF_beta_Receptor Signaling Pathway
References
Ref 521450ClinicalTrials.gov (NCT00003125) Vaccine Therapy, Interleukin-2, and Sargramostim in Treating Patients With Advanced Tumors. U.S. National Institutes of Health.
Ref 521707ClinicalTrials.gov (NCT00203892) Study of CAP1-6D in Patients With Locally Advanced or Surgically Resected Pancreatic Adenocarcinoma. U.S. National Institutes of Health.
Ref 522116ClinicalTrials.gov (NCT00529984) A Phase I/II Study With CEA(6D) VRP Vaccine in Patients With Advanced or Metastatic CEA-Expressing Malignancies. U.S. National Institutes of Health.
Ref 522271ClinicalTrials.gov (NCT00645710) Hepatic Arterial Infusion of Floxuridine, Gemcitabine Hydrochloride, and Radiolabeled Monoclonal Antibody Therapy in Treating Liver Metastases in Patients With Metastatic Colorectal Cancer Previously Treated With Surgery. U.S. National Institutes of Health.
Ref 524297ClinicalTrials.gov (NCT01856920) A Phase 2 Study of GI-6207 in Patients With Recurrent Medullary Thyroid Cancer. U.S. National Institutes of Health.
Ref 524831ClinicalTrials.gov (NCT02187848) Evaluation of SAR408701 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health.
Ref 527751Phase II trial of carcinoembryonic antigen radioimmunotherapy with 131I-labetuzumab after salvage resection of colorectal metastases in the liver: five-year safety and efficacy results. J Clin Oncol.2005 Sep 20;23(27):6763-70.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 530224A phase I trial of radioimmunotherapy with 131I-A5B7 anti-CEA antibody in combination with combretastatin-A4-phosphate in advanced gastrointestinal carcinomas. Clin Cancer Res. 2009 Jul 1;15(13):4484-92.
Ref 530664Phase I trial of intraperitoneal administration of an oncolytic measles virus strain engineered to express carcinoembryonic antigen for recurrent ovarian cancer. Cancer Res. 2010 Feb 1;70(3):875-82.
Ref 531534Phase I clinical trial of the (131)I-labeled anticarcinoembryonic antigen CIGB-M3 multivalent antibody fragment. Cancer Biother Radiopharm. 2011 Jun;26(3):353-63.
Ref 546628Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009269)
Ref 547157Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013510)
Ref 549518Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039398)
Ref 549707J Clin Oncol 28:15s, 2010 (suppl, abstr 2579).
Ref 524831ClinicalTrials.gov (NCT02187848) Evaluation of SAR408701 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health.
Ref 525630Clinical and immune responses in resected colon cancer patients treated with anti-idiotype monoclonal antibody vaccine that mimics the carcinoembryonic antigen. J Clin Oncol. 1999 Sep;17(9):2889-5.
Ref 526990Technology evaluation: cT84.66, City of Hope. Curr Opin Mol Ther. 2004 Feb;6(1):90-5.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 530664Phase I trial of intraperitoneal administration of an oncolytic measles virus strain engineered to express carcinoembryonic antigen for recurrent ovarian cancer. Cancer Res. 2010 Feb 1;70(3):875-82.
Ref 530852HLA-A*0201-restricted CEA-derived peptide CAP1 is not a suitable target for T-cell-based immunotherapy. J Immunother. 2010 May;33(4):402-13.
Ref 531534Phase I clinical trial of the (131)I-labeled anticarcinoembryonic antigen CIGB-M3 multivalent antibody fragment. Cancer Biother Radiopharm. 2011 Jun;26(3):353-63.
Ref 531635Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36.
Ref 531637Viral vector-based therapeutic cancer vaccines. Cancer J. 2011 Sep-Oct;17(5):359-71.
Ref 534511Identification of an enhancer agonist cytotoxic T lymphocyte peptide from human carcinoembryonic antigen. Cancer Res. 1997 Oct 15;57(20):4570-7.
Ref 543726(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2836).
Ref 543999Crystal structure of the anti-(carcinoembryonic antigen) single-chain Fv antibody MFE-23 and a model for antigen binding based on intermolecular contacts.. Biochem J. 2000 March 1; 346(Pt 2): 519-528.
Ref 544124Antibody fragments: Hope and hype. MAbs. 2010 Jan-Feb; 2(1): 77-83.
Ref 549721Anticancer Antibodies. (2003) American Journal of Clinical Pathology, 119, 472-485.
Ref 550036New horizons for prostate cancer. Trends in Urology & Men's Health 05/2013; 4(3).
Ref 550467National Cancer Institute Drug Dictionary (drug id 692828).
Ref 551006Clinical pipeline report, company report or official report of Immunomedics.
Ref 551608Clinical pipeline report, company report or official report of Roche.
Ref 551895Clinical pipeline report, company report or official report of GlobeImmune.