Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T95371
|
||||
| Former ID |
TTDNC00373
|
||||
| Target Name |
IFN-alphaR
|
||||
| Gene Name |
IFNAR1
|
||||
| Synonyms |
CRF21; Cytokine receptor classII member 1; Cytokine receptor family 2 member 1; IFNR1; IFNalpha/beta receptor 1; Interferon alpha/beta receptor 1; Type I interferon receptor 1; IFNAR1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2] | ||||
| HBV infection [ICD9: 070.2-070.3; ICD10: B16, B18.0, B18.1] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Function |
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves. .
|
||||
| BioChemical Class |
Type II cytokine receptor
|
||||
| UniProt ID | |||||
| Sequence |
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN EDESESKTSEELQQDFV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | EMZ701 | Drug Info | Phase 2 | HBV infection | [551742] |
| MEDI-546 | Drug Info | Phase 2 | Ovarian cancer | [533114], [543016] | |
| R-IFN-1a | Drug Info | Phase 2 | HCV infection | [534317] | |
| Zadaxin/lamivudine | Drug Info | Phase 2 | HBV infection | [549869] | |
| Belerofon | Drug Info | Phase 1 | HCV infection | [551542] | |
| Omega interferon | Drug Info | Discontinued in Phase 2 | HCV infection | [545956] | |
| BLX-883 | Drug Info | Discontinued in Phase 1 | HCV infection | [548100] | |
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| PI3K-Akt signaling pathway | |||||
| Osteoclast differentiation | |||||
| Toll-like receptor signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| Natural killer cell mediated cytotoxicity | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| Leptin Signaling Pathway | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Pathway Interaction Database | Downstream signaling in na& | ||||
| #xef | |||||
| ve CD8+ T cells | |||||
| Reactome | Interferon alpha/beta signaling | ||||
| Regulation of IFNA signaling | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Interferon type I signaling pathways | |||||
| Interferon alpha/beta signaling | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| Osteoclast Signaling | |||||
| References | |||||
| Ref 533114 | Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39. | ||||
| Ref 534317 | A phase II study of recombinant interferon-beta (r-hIFN-beta 1a) in combination with 5-fluorouracil (5-FU) in the treatment of patients with advanced colorectal carcinoma. Br J Cancer. 1997;75(3):423-6. | ||||
| Ref 543016 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8258). | ||||
| Ref 545956 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005492) | ||||
| Ref 548100 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021901) | ||||
| Ref 525616 | Further study on the specificity and incidence of neutralizing antibodies to interferon (IFN) in relapsing remitting multiple sclerosis patients treated with IFN beta-1a or IFN beta-1b. J Neurol Sci.1999 Oct 15;168(2):131-6. | ||||
| Ref 527615 | Zadaxin (thymosin alpha1) for the treatment of viral hepatitis. Expert Opin Investig Drugs. 1999 Mar;8(3):281-7. | ||||
| Ref 531836 | Resistance to mericitabine, a nucleoside analogue inhibitor of HCV RNA-dependent RNA polymerase. Antivir Ther. 2012;17(3):411-23. | ||||
| Ref 533114 | Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39. | ||||
