Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T73724
|
||||
| Former ID |
TTDR00164
|
||||
| Target Name |
Neuronal acetylcholine receptor protein, beta-4 chain
|
||||
| Gene Name |
CHRNB4
|
||||
| Synonyms |
Beta-4 nAChR; CHRNB4
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
|
||||
| BioChemical Class |
Ion transport
|
||||
| Target Validation |
T73724
|
||||
| UniProt ID | |||||
| Sequence |
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP PLFQTHAASEGPYAAQRD |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | ||
| (2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | |||
| 15-nor-18-Methoxycornaridine | Drug Info | [526639] | |||
| 18-Dimethylaminocoronaridine | Drug Info | [526639] | |||
| 18-methoxycoronaridinate 2-Hydroxyethylamide | Drug Info | [526639] | |||
| 18-methoxycoronaridinate 2-methoxyethylamide | Drug Info | [526639] | |||
| 18-Methylaminocoronaridine | Drug Info | [526639] | |||
| 2-Acetylaminoethyl 18-methoxycoronaridinate | Drug Info | [526639] | |||
| 2-Hydroxyethyl 18-methoxycoronaridinate | Drug Info | [526639] | |||
| 2-Methoxyethyl 18-methoxycoronaridinate | Drug Info | [526639] | |||
| CYTISINE | Drug Info | [529383] | |||
| GCCSNPVCHLEHSNLC* | Drug Info | [527644] | |||
| HOMOEPIBATIDINE | Drug Info | [528394] | |||
| N,N-Dimethylaminoethyl 18-methoxycoronaridinate | Drug Info | [526639] | |||
| Agonist | SIB-1553A | Drug Info | [535261] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Cholinergic synapse | |||||
| PANTHER Pathway | Nicotinic acetylcholine receptor signaling pathway | ||||
| Nicotine pharmacodynamics pathway | |||||
| Reactome | Highly sodium permeable acetylcholine nicotinic receptors | ||||
| Highly calcium permeable postsynaptic nicotinic acetylcholine receptors | |||||
| Highly calcium permeable nicotinic acetylcholine receptors | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
| Nicotine Activity on Chromaffin Cells | |||||
| References | |||||
| Ref 526639 | J Med Chem. 2003 Jun 19;46(13):2716-30.Synthesis and biological evaluation of 18-methoxycoronaridine congeners. Potential antiaddiction agents. | ||||
| Ref 527644 | J Med Chem. 2005 Jul 28;48(15):4705-45.Neuronal nicotinic acetylcholine receptors: structural revelations, target identifications, and therapeutic inspirations. | ||||
| Ref 528394 | Bioorg Med Chem Lett. 2006 Nov 1;16(21):5493-7. Epub 2006 Aug 28.Epibatidine isomers and analogues: structure-activity relationships. | ||||
| Ref 529383 | Bioorg Med Chem Lett. 2008 Apr 1;18(7):2316-9. Epub 2008 Mar 6.Deconstructing cytisine: The syntheses of (+/-)-cyfusine and (+/-)-cyclopropylcyfusine, fused ring analogs of cytisine. | ||||
| Ref 530946 | J Med Chem. 2010 Jun 24;53(12):4731-48.Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. | ||||
| Ref 535261 | SIB-1553A, (+/-)-4-[[2-(1-methyl-2-pyrrolidinyl)ethyl]thio]phenol hydrochloride, a subtype-selective ligand for nicotinic acetylcholine receptors with putative cognitive-enhancing properties: effectson working and reference memory performances in aged rodents and nonhuman primates. J Pharmacol Exp Ther. 2001 Oct;299(1):297-306. | ||||
