Target General Infomation
Target ID
T06671
Former ID
TTDC00221
Target Name
Interleukin-18
Gene Name
IL18
Synonyms
IFN-gamma-inducing factor; IL-1 gamma; IL-18; Interferon-gamma inducing factor; Interleukin-1 gamma; IL18
Target Type
Clinical Trial
Disease B-cell non-hodgkin's lymphoma; Rheumatoid arthritis [ICD9: 200, 202, 202.8, 710-719, 714; ICD10: C81-C86, C82-C85, M00-M25, M05-M06]
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47]
Non-hodgkin's lymphoma; Follicular lymphoma [ICD9: 200, 202, 202.0, 202.8; ICD10: C81-C86, C82, C82-C85]
Non-hodgkin's lymphoma; Ovarian cancer [ICD9:183; ICD10: C85, C56]
Ovarian cancer [ICD9: 183; ICD10: C56]
Type 2 diabetes [ICD9: 250; ICD10: E11]
Function
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
BioChemical Class
Cytokine: interleukin
Target Validation
T06671
UniProt ID
Sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
Drugs and Mode of Action
Drug(s) GSK-1070806 Drug Info Phase 2 Type 2 diabetes [523987]
Iboctadekin Drug Info Phase 1 Non-hodgkin's lymphoma; Ovarian cancer [546479]
Iboctadekin + Doxil Drug Info Phase 1 Ovarian cancer [522292], [550972]
Iboctadekin + rituximab Drug Info Phase 1 Non-hodgkin's lymphoma; Follicular lymphoma [549706]
MEDI-2338 Drug Info Phase 1 Chronic obstructive pulmonary disease [523408]
IL-18BP Drug Info Discontinued in Phase 1 B-cell non-hodgkin's lymphoma; Rheumatoid arthritis [547123]
Modulator Iboctadekin Drug Info [550351]
Iboctadekin + Doxil Drug Info [550963]
Iboctadekin + rituximab Drug Info [550963]
MEDI-2338 Drug Info [544401]
Binder IL-18BP Drug Info [536651]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Salmonella infection
Legionellosis
African trypanosomiasis
Malaria
Tuberculosis
Influenza A
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
NetPath Pathway IL4 Signaling Pathway
PANTHER Pathway Interleukin signaling pathway
Toll receptor signaling pathway
Pathway Interaction Database IL27-mediated signaling events
IL12-mediated signaling events
IL23-mediated signaling events
Cellular roles of Anthrax toxin
IL12 signaling mediated by STAT4
Reactome Interleukin-1 processing
WikiPathways Hypertrophy Model
IL1 and megakaryotyces in obesity
Corticotropin-releasing hormone
NOD pathway
References
Ref 522292ClinicalTrials.gov (NCT00659178) Combination Study Of SB-485232 (Interleukin 18) And Doxil For Advanced Stage Epithelial Ovarian Cancer. U.S. National Institutes of Health.
Ref 523408ClinicalTrials.gov (NCT01322594) A Study to Evaluate the Safety of MEDI2338 in Subjects With Chronic Obstructive Pulmonary Disease. U.S. National Institutes of Health.
Ref 523987ClinicalTrials.gov (NCT01648153) Investigate the Efficacy and Safety of GSK1070806 in Obese Subjects With T2DM. U.S. National Institutes of Health.
Ref 546479Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008435)
Ref 547123Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013227)
Ref 549706J Clin Oncol 27:15s, 2009 (suppl, abstr 8566).
Ref 550972Clinical pipeline report, company report or official report of GlaxoSmithKline.
Ref 536651Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
Ref 544164Targeting the IL-1 family members in skin inflammation. Curr Opin Investig Drugs. 2010 November; 11(11): 1211-1220.
Ref 544401Cytokine inhibition in the treatment of COPD. Int J Chron Obstruct Pulmon Dis. 2014; 9: 397-412.
Ref 550351Chemoimmunotherapy using pegylated liposomal Doxorubicin and interleukin-18 in recurrent ovarian cancer: a phase I dose-escalation study. Cancer Immunol Res. 2013 Sep;1(3):168-78.
Ref 550963Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).