Target General Infomation
Target ID
T34743
Former ID
TTDS00213
Target Name
DNA
Gene Name
dacA
Synonyms
Penicillin binding protein; dacA
Target Type
Successful
Disease Acute bronchitis [ICD10: J20-J21, J42]
Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0]
Acute myeloid leukemia [ICD9: 205; ICD10: C92.0]
Arthritis [ICD9: 710-719; ICD10: M00-M25]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Brain cancer; Glioma [ICD9:191, 225.0; ICD10: C71, D33]
Chronic bronchitis [ICD10: J42]
Cystic fibrosis [ICD9: 277; ICD10: E84]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Chronic lymphocytic leukaemia [ICD10: C91]
Dietary shortage [ICD9: 260-269; ICD10: E40-E46]
Fungal infections [ICD9: 110-118; ICD10: B35-B49]
Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104]
Gastrointestinal cancers; Breast cancers [ICD9: 150-159, 174, 175; ICD10: C15-C26, C50]
Hodgkin's lymphoma [ICD10: C81]
Herpes simplex virus infection [ICD9: 54; ICD10: B00]
Infections of the upper and lower urinary tract [ICD10: A00-B99]
Infections by susceptible microorganisms [ICD10: A00-B99]
Leukemia [ICD9: 208.9; ICD10: C90-C95]
Lupus nephritis [ICD9: 583.81; ICD10: M32.1, N08.5]
Malaria [ICD10: B54]
Myelodysplastic syndrome; Acute lymphoblastic leukemia [ICD9:238.7, 204.0, 556; ICD10: D46, C91.0]
Metastatic islet cell carcinoma [ICD9: 157.4; ICD10: C25.4]
Melanoma [ICD9: 172; ICD10: C43]
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89]
Ovarian cancer [ICD9: 183; ICD10: C56]
Psoriasis; Cutaneous T-cell lymphoma [ICD9:696, 202.1, 202.2; ICD10: L40, C84.0, C84.1]
Pseudomonas aeruginosa infection; Haemophilus influenzae infection [ICD10: B96.5]
Refractory chronic myeloid leukaemia [ICD9: 205.1; ICD10: C92.1]
Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma [ICD10: C81-C86]
Systemic lupus erythematosus [ICD9: 710; ICD10: M32]
Sepsis [ICD9: 995.91; ICD10: A40, A41]
Urinary tract infections [ICD9: 599; ICD10: N39.0]
Target Validation
T34743
UniProt ID
Sequence
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV
GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
Drugs and Mode of Action
Drug(s) Adenine Drug Info Approved Dietary shortage [468017], [550673]
Altretamine Drug Info Approved Ovarian cancer [538535], [542119]
Ampicillin Drug Info Approved Bacterial infections [538200]
Azlocillin Drug Info Approved Pseudomonas aeruginosa infection; Haemophilus influenzae infection [551871]
Bacampicillin Drug Info Approved Bacterial infections [538600]
Balofloxacin Drug Info Approved Gram-positive bacterial infection [536094]
Bleomycin Drug Info Approved Hodgkin's lymphoma [536361]
Carbenicillin Drug Info Approved Infections of the upper and lower urinary tract [551871]
Cefacetrile Drug Info Approved Bacterial infections [550676]
Cefaclor Drug Info Approved Bacterial infections [538203]
Cefadroxil Drug Info Approved Bacterial infections [468064], [538205]
Cefamandole Drug Info Approved Infections by susceptible microorganisms [551871]
Cefazolin Drug Info Approved Bacterial infections [538217]
Cefdinir Drug Info Approved Bacterial infections [536222]
Cefditoren Drug Info Approved Bacterial infections [536361]
Cefixime Drug Info Approved Bacterial infections [536361]
Cefonicid Drug Info Approved Bacterial infections [536361]
Cefoperazone Drug Info Approved Bacterial infections [536361]
Ceforanide Drug Info Approved Bacterial infections [536361]
Cefotetan Drug Info Approved Bacterial infections [536361]
Cefoxitin Drug Info Approved Bacterial infections [536361]
Cefpiramide Drug Info Approved Bacterial infections [536361]
Cefpodoxime Drug Info Approved Bacterial infections [536361]
Cefprozil Drug Info Approved Bacterial infections [536361]
Cefradine Drug Info Approved Bacterial infections [468063], [544499]
Ceftazidime Drug Info Approved Bacterial infections [536361]
Ceftibuten Drug Info Approved Chronic bronchitis [551871]
Ceftizoxime Drug Info Approved Bacterial infections [536361]
Cefuroxime Drug Info Approved Acute bronchitis [551871]
Cephalexin Drug Info Approved Bacterial infections [468065], [538201]
Cephapirin Drug Info Approved Sepsis [538207], [551871]
Chlorambucil Drug Info Approved Chronic lymphocytic leukaemia [538433], [542151]
Ciprofloxacin XR Drug Info Approved Gram-positive bacterial infection [536094]
Clofarabine Drug Info Approved Myelodysplastic syndrome; Acute lymphoblastic leukemia [527466], [536361], [541885], [551871]
Cloxacillin Drug Info Approved Bacterial infections [538198]
Cyclacillin Drug Info Approved Bacterial infections [468048], [538209], [551871]
Dacarbazine Drug Info Approved Melanoma [538295]
Dactinomycin Drug Info Approved Cancer [538603]
Dicloxacillin Drug Info Approved Bacterial infections [538204]
Dornase Alfa Drug Info Approved Cystic fibrosis [536361]
Elliptinium acetate Drug Info Approved Cancer [551871]
Ertapenem Drug Info Approved Bacterial infections [536361]
Flucloxacillin Drug Info Approved Bacterial infections [550700]
Idoxuridine Drug Info Approved Herpes simplex virus infection [538467]
Lomustine Drug Info Approved Brain cancer; Glioma [538491], [542229], [551871]
Loracarbef Drug Info Approved Bacterial infections [536361]
Mechlorethamine Drug Info Approved Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma [551871]
Mercaptopurine Drug Info Approved Acute lymphoblastic leukemia [537297], [542241]
Methoxsalen Drug Info Approved Psoriasis; Cutaneous T-cell lymphoma [538412], [551871]
Methylene blue Drug Info Approved Acquired methemoglobinemia [538085]
Meticillin Drug Info Approved Bacterial infections [550731]
Mitomycin Drug Info Approved Gastrointestinal cancers; Breast cancers [536361], [542094]
Mitomycin A Drug Info Approved Cancer [536361]
Mitomycin C Drug Info Approved Cancer [536361]
Nafcillin Drug Info Approved Arthritis [538206], [551871]
Nelarabine Drug Info Approved Leukemia [536361], [536644], [542096], [551186]
Neocarzinostatin Drug Info Approved Cancer [551871]
Nitrofurantoin Drug Info Approved Urinary tract infections [538414]
Oxacillin Drug Info Approved Bacterial infections [538199]
Penicillin V Drug Info Approved Bacterial infections [536773]
Piperacillin Drug Info Approved Bacterial infections [536823]
Pipobroman Drug Info Approved Refractory chronic myeloid leukaemia [538475], [542291], [551871]
Pirarubicin Drug Info Approved Breast cancer [524155], [551871]
Pivampicillin Drug Info Approved Bacterial infections [550745]
Pivmecillinam Drug Info Approved Urinary tract infections [550761], [551871]
Primaquine Drug Info Approved Malaria [538406]
Procarbazine Drug Info Approved Hodgkin's lymphoma [538480], [542298]
Proflavine Drug Info Approved Sepsis [550748]
Streptozocin Drug Info Approved Metastatic islet cell carcinoma [536361]
Thioguanine Drug Info Approved Acute myeloid leukemia [536361], [541925]
Ticarcillin Drug Info Approved Bacterial infections [538597]
Uracil mustard Drug Info Approved Acute myeloid leukemia [536361], [542609], [551871]
Zinostatin stimalamer Drug Info Approved Brain cancer [551871]
Mechlorethamine Drug Info Phase 3 Hodgkin's lymphoma [542232], [551871]
Indol-3-carbinol Drug Info Preclinical Fungal infections [537364]
Abetimus sodium Drug Info Discontinued in Phase 3 Lupus nephritis [536055]
TV-4710 Drug Info Discontinued in Phase 2 Systemic lupus erythematosus [536055]
Talisomycin Drug Info Terminated Discovery agent [544740]
Meticillin Drug Info Investigative Neurological disease [525919]
Inhibitor 2-(3,4-Dihydroxyphenyl)Acetic Acid Drug Info [551393]
Abetimus sodium Drug Info [536055]
Balofloxacin Drug Info [536094]
Beta-D-Glucose Drug Info [551393]
Ciprofloxacin XR Drug Info [536094]
Lipid Fragment Drug Info [551393]
Lomustine Drug Info [536461]
Phosphomethylphosphonic Acid Adenosyl Ester Drug Info [551393]
Thiamin Diphosphate Drug Info [551393]
TV-4710 Drug Info [536055]
Intercalator Actinomycin D Drug Info [535170]
Adriamycin Drug Info [537817]
Ametantrone Drug Info [537764]
Chlorambucil Drug Info [537444]
Daunomycin Drug Info [537682]
Ethidium Drug Info [537682]
Mechlorethamine Drug Info [537392]
Nogalamycin Drug Info [534880]
Thioguanine Drug Info [537106]
Binder Adenine Drug Info [536215], [537584]
Ampicillin Drug Info [535430]
Azlocillin Drug Info [537684]
Bacampicillin Drug Info [536284]
Carbenicillin Drug Info [537657]
Cefacetrile Drug Info [536792]
Cefaclor Drug Info [536052]
Cefadroxil Drug Info [538061]
Cefamandole Drug Info [538071]
Cefazolin Drug Info [536598]
Cefdinir Drug Info [536431]
Cefditoren Drug Info [536486]
Cefixime Drug Info [537473]
Cefonicid Drug Info [537802]
Cefoperazone Drug Info [538144]
Ceforanide Drug Info [535771]
Cefotetan Drug Info [536418]
Cefoxitin Drug Info [536821]
Cefpiramide Drug Info [536284]
Cefpodoxime Drug Info [536267]
Cefprozil Drug Info [536099]
Cefradine Drug Info [536821]
Ceftazidime Drug Info [536645]
Ceftibuten Drug Info [537479]
Ceftizoxime Drug Info [536047]
Cefuroxime Drug Info [535705]
Cephalexin Drug Info [535908]
Cephapirin Drug Info [537909]
Clofarabine Drug Info [536496]
Cloxacillin Drug Info [536385]
Cyclacillin Drug Info [536284]
Dicloxacillin Drug Info [537799]
Ertapenem Drug Info [536047]
Flucloxacillin Drug Info [537799]
Idoxuridine Drug Info [534878]
Indol-3-carbinol Drug Info [537364]
Loracarbef Drug Info [536267]
Methoxsalen Drug Info [537800]
Meticillin Drug Info [536269]
Mitomycin Drug Info [537608]
Nafcillin Drug Info [537679]
Nelarabine Drug Info [536644]
Oxacillin Drug Info [537307]
Penicillin V Drug Info [537832]
Piperacillin Drug Info [536021]
Pipobroman Drug Info [537776]
Pivampicillin Drug Info [536284]
Pivmecillinam Drug Info [536997]
Proflavine Drug Info [537222]
Ticarcillin Drug Info [537929]
Breaker Altretamine Drug Info [536640]
Bleomycin Drug Info [537784]
Dacarbazine Drug Info [537543]
Dactinomycin Drug Info [534930]
Dornase Alfa Drug Info [536538]
Duocarmycin Drug Info [534930]
Enediyne antibiotics Drug Info [534930]
Mercaptopurine Drug Info [537146]
Nitracrine Drug Info [534871]
Nitrofurantoin Drug Info [537957]
Streptozocin Drug Info [537542]
Talisomycin Drug Info [537784]
Binder (minor groove binder) Bisbenzimide (Hoechst 33258) Drug Info [537830]
Di-imidazole lexitropsin Drug Info [538053]
Distamycin A Drug Info [535333]
Netropsin Drug Info [537664]
Modulator Elliptinium acetate Drug Info [527631], [534365], [536361]
Neocarzinostatin Drug Info [536361]
Pirarubicin Drug Info [536361]
Uracil mustard Drug Info [537960]
Zinostatin stimalamer Drug Info [536361]
References
Ref 468017(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4788).
Ref 468048(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4817).
Ref 468063(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4830).
Ref 468064(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4831).
Ref 468065(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4832).
Ref 524155ClinicalTrials.gov (NCT01746992) CTOP/ITE/MTX Compared With CHOP as the First-line Therapy for Newly Diagnosed Young Patients With T Cell Lymphoma. U.S. National Institutes of Health.
Ref 525919Alpha-conotoxins. Int J Biochem Cell Biol. 2000 Oct;32(10):1017-28.
Ref 5274662004 approvals: the demise of the blockbuster. Nat Rev Drug Discov. 2005 Feb;4(2):93-4.
Ref 536055Emergence of targeted immune therapies for systemic lupus. Expert Opin Emerg Drugs. 2005 Feb;10(1):53-65.
Ref 536094Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98.
Ref 536222Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536644Nelarabine. Drugs. 2008;68(4):439-47.
Ref 536773How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30.
Ref 536823Zosyn (piperacillin/tazobactam) reformulation: Expanded compatibility and coadministration with lactated Ringer's solutions and selected aminoglycosides. Ther Clin Risk Manag. 2008 Apr;4(2):303-14.
Ref 537297S-adenosylmethionine regulates thiopurine methyltransferase activity and decreases 6-mercaptopurine cytotoxicity in MOLT lymphoblasts. Biochem Pharmacol. 2009 Jun 15;77(12):1845-53. Epub 2009 Mar 19.
Ref 537364Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7.
Ref 538085Recombinant Plasmodium falciparum glutathione reductase is inhibited by the antimalarial dye methylene blue. FEBS Lett. 1998 Feb 6;422(3):311-4.
Ref 538198FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061454.
Ref 538199FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061490.
Ref 538200FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061936.
Ref 538201FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061969.
Ref 538203FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062206.
Ref 538204FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062286.
Ref 538205FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062291.
Ref 538206FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062527.
Ref 538207FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062720.
Ref 538209FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062895.
Ref 538217FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065244.
Ref 538295FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075259.
Ref 538406FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008316.
Ref 538412FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009048.
Ref 538414FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009175.
Ref 538433FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010669.
Ref 538467FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 014169.
Ref 538475FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016245.
Ref 538480FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016785.
Ref 538491FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017588.
Ref 538535FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019926.
Ref 538597FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050497.
Ref 538600FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050520.
Ref 538603FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050682.
Ref 541885(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6802).
Ref 541925(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6845).
Ref 542094(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7089).
Ref 542096(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7090).
Ref 542119(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7112).
Ref 542151(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7143).
Ref 542229(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7214).
Ref 542232(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7218).
Ref 542241(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7226).
Ref 542291(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7271).
Ref 542298(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7278).
Ref 542609(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7621).
Ref 544499Textbook of Therapeutics: Drug and Disease Management. 2006, P892. By Richard A. Helms, Eric T. Herfindal, David J. Quan, Dick R. Gourley.
Ref 544740Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000802)
Ref 550673Drug information of Adenine, 2008. eduDrugs.
Ref 550676Drug information of Cefacetrile, 2008. eduDrugs.
Ref 550700Drug information of Flucloxacillin, 2008. eduDrugs.
Ref 550731Drug information of Meticillin, 2008. eduDrugs.
Ref 550745Drug information of Pivampicillin, 2008. eduDrugs.
Ref 550748Drug information of Proflavine, 2008. eduDrugs.
Ref 550761Drug information of Pivmecillinam, 2008. eduDrugs.
Ref 5511862005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 527631Plants as a source of anti-cancer agents. J Ethnopharmacol. 2005 Aug 22;100(1-2):72-9.
Ref 534365Stationary potential of the brain: Part II. Clinical studies. Neurol Med Chir (Tokyo). 1979 Jul;19(7):655-64.
Ref 534871Crosslinking of cellular DNA by nitracrine and furocoumarin derivatives. Neoplasma. 1999;46(1):50-3.
Ref 534878Radiopharmaceuticals (Strontium 89) and radiosensitizers (idoxuridine). J Intraven Nurs. 1998 Nov-Dec;21(6):335-7.
Ref 534880Structure, dynamics and hydration of the nogalamycin-d(ATGCAT)2Complex determined by NMR and molecular dynamics simulations in solution. J Mol Biol. 1999 Jul 16;290(3):699-716.
Ref 534930Structural studies of atom-specific anticancer drugs acting on DNA. Pharmacol Ther. 1999 Sep;83(3):181-215.
Ref 535170Crystallographic analysis of a novel complex of actinomycin D bound to the DNA decamer CGATCGATCG. Biochemistry. 2001 May 15;40(19):5587-92.
Ref 535232Selective activation of mitomycin A by thiols to form DNA cross-links and monoadducts: biochemical basis for the modulation of mitomycin cytotoxicity by the quinone redox potential. J Med Chem. 2001 Aug 16;44(17):2834-42.
Ref 535333Development of distamycin-related DNA binding anticancer drugs. Expert Opin Investig Drugs. 2001 Sep;10(9):1703-14.
Ref 535430Effects of amino acid alterations in penicillin-binding proteins (PBPs) 1a, 2b, and 2x on PBP affinities of penicillin, ampicillin, amoxicillin, cefditoren, cefuroxime, cefprozil, and cefaclor in 18 clinical isolates of penicillin-susceptible, -intermediate, and -resistant pneumococci. Antimicrob Agents Chemother. 2002 May;46(5):1273-80.
Ref 535705Cefuroxime resistance in non-beta-lactamase Haemophilus influenzae is linked to mutations in ftsI. J Antimicrob Chemother. 2003 Mar;51(3):523-30.
Ref 535771The pharmacokinetics of the interstitial space in humans. BMC Clin Pharmacol. 2003 Jul 30;3:3.
Ref 535908Relationship between penicillin-binding protein patterns and beta-lactamases in clinical isolates of Bacteroides fragilis with different susceptibility to beta-lactam antibiotics. J Med Microbiol. 2004 Mar;53(Pt 3):213-21.
Ref 536021In vitro antienterococcal activity explains associations between exposures to antimicrobial agents and risk of colonization by multiresistant enterococci. J Infect Dis. 2004 Dec 15;190(12):2162-6. Epub 2004 Nov 16.
Ref 536047Role of penicillin-binding protein 2 (PBP2) in the antibiotic susceptibility and cell wall cross-linking of Staphylococcus aureus: evidence for the cooperative functioning of PBP2, PBP4, and PBP2A. JBacteriol. 2005 Mar;187(5):1815-24.
Ref 536052Antibacterial activity of oral cephems against various clinically isolated strains and evaluation of efficacy based on the pharmacokinetics/pharmacodynamics theory. Jpn J Antibiot. 2004 Dec;57(6):465-74.
Ref 536055Emergence of targeted immune therapies for systemic lupus. Expert Opin Emerg Drugs. 2005 Feb;10(1):53-65.
Ref 536094Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98.
Ref 536099Microbiology and antimicrobial management of sinusitis. J Laryngol Otol. 2005 Apr;119(4):251-8.
Ref 536215Leishmania donovani singly deficient in HGPRT, APRT or XPRT are viable in vitro and within mammalian macrophages. Mol Biochem Parasitol. 2006 Jul;148(1):24-30. Epub 2006 Mar 15.
Ref 536267Amino acid substitutions in mosaic penicillin-binding protein 2 associated with reduced susceptibility to cefixime in clinical isolates of Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2006 Nov;50(11):3638-45. Epub 2006 Aug 28.
Ref 536269A link in transcription between the native pbpB and the acquired mecA gene in a strain of Staphylococcus aureus. Microbiology. 2006 Sep;152(Pt 9):2549-58.
Ref 536284Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536385Development of a receptor-based microplate assay for the detection of beta-lactam antibiotics in different food matrices. Anal Chim Acta. 2007 Mar 14;586(1-2):296-303. Epub 2006 Sep 26.
Ref 536418In-vitro profile of a new beta-lactam, ceftobiprole, with activity against methicillin-resistant Staphylococcus aureus. Clin Microbiol Infect. 2007 Jun;13 Suppl 2:17-24.
Ref 536431Decreased affinity of mosaic-structure recombinant penicillin-binding protein 2 for oral cephalosporins in Neisseria gonorrhoeae. J Antimicrob Chemother. 2007 Jul;60(1):54-60. Epub 2007 May 31.
Ref 536461Synthesis and evaluation of ethylnitrosoureas of substituted naphthalimides as anticancer compounds. Acta Pol Pharm. 2007 Jan-Feb;64(1):27-33.
Ref 536470Primaquine-induced differential gene expression analysis in mice liver using DNA microarrays. Toxicology. 2007 Sep 24;239(1-2):96-107. Epub 2007 Jul 1.
Ref 536486Crystal structure of cefditoren complexed with Streptococcus pneumoniae penicillin-binding protein 2X: structural basis for its high antimicrobial activity. Antimicrob Agents Chemother. 2007 Nov;51(11):3902-7. Epub 2007 Aug 27.
Ref 536496Clofarabine: past, present, and future. Leuk Lymphoma. 2007 Oct;48(10):1922-30.
Ref 536538Dornase alfa. BioDrugs. 1997 Dec;8(6):439-45.
Ref 536598Bacteriological characteristics of Staphylococcus aureus isolates from humans and bulk milk. J Dairy Sci. 2008 Feb;91(2):564-9.
Ref 536640Synergy of irofulven in combination with other DNA damaging agents: synergistic interaction with altretamine, alkylating, and platinum-derived agents in the MV522 lung tumor model. Cancer Chemother Pharmacol. 2008 Dec;63(1):19-26. Epub 2008 Feb 28.
Ref 536644Nelarabine. Drugs. 2008;68(4):439-47.
Ref 536645New and emerging treatment of Staphylococcus aureus infections in the hospital setting. Clin Microbiol Infect. 2008 Apr;14 Suppl 3:32-41.
Ref 536792Single dose 1 g ceftriaxone for urogenital and pharyngeal infection caused by Neisseria gonorrhoeae. Int J Urol. 2008 Sep;15(9):837-42. Epub 2008 Jul 25.
Ref 536821Staphylococcus aureus PBP4 is essential for beta-lactam resistance in community-acquired methicillin-resistant strains. Antimicrob Agents Chemother. 2008 Nov;52(11):3955-66. Epub 2008 Aug 25.
Ref 536874Brca2/Xrcc2 dependent HR, but not NHEJ, is required for protection against O(6)-methylguanine triggered apoptosis, DSBs and chromosomal aberrations by a process leading to SCEs. DNA Repair (Amst). 2009 Jan 1;8(1):72-86. Epub 2008 Oct 21.
Ref 536997Association between antimicrobial consumption and resistance in Escherichia coli. Antimicrob Agents Chemother. 2009 Mar;53(3):912-7. Epub 2008 Dec 22.
Ref 537036Naphthyridinomycin-DNA adducts: a molecular modeling study. J Antibiot (Tokyo). 1991 Aug;44(8):885-94.
Ref 537106Immune effector cells produce lethal DNA damage in cells treated with a thiopurine. Cancer Res. 2009 Mar 15;69(6):2393-9. Epub 2009 Feb 24.
Ref 5371466-mercaptopurine (6-MP) induces p53-mediated apoptosis of neural progenitor cells in the developing fetal rodent brain. Neurotoxicol Teratol. 2009 Jul-Aug;31(4):198-202. Epub 2009 Mar 10.
Ref 537222Interaction of small molecules with double-stranded RNA: spectroscopic, viscometric, and calorimetric study of hoechst and proflavine binding to PolyCG structures. DNA Cell Biol. 2009 Apr;28(4):209-19.
Ref 537307Novel anion liposome-encapsulated antisense oligonucleotide restores susceptibility of methicillin-resistant Staphylococcus aureus and rescues mice from lethal sepsis by targeting mecA. Antimicrob Agents Chemother. 2009 Jul;53(7):2871-8. Epub 2009 May 11.
Ref 537364Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7.
Ref 537392Proteomic analysis of DNA-protein cross-linking by antitumor nitrogen mustards. Chem Res Toxicol. 2009 Jun;22(6):1151-62.
Ref 537444Roles of DNA repair and reductase activity in the cytotoxicity of the hypoxia-activated dinitrobenzamide mustard PR-104A. Mol Cancer Ther. 2009 Jun;8(6):1714-23. Epub 2009 Jun 9.
Ref 537473Genetics of chromosomally mediated intermediate resistance to ceftriaxone and cefixime in Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2009 Jun 15.
Ref 537479Neisseria gonorrhoeae and emerging resistance to extended spectrum cephalosporins. Curr Opin Infect Dis. 2009 Feb;22(1):87-91.
Ref 537542Hydrodynamics-based Transfection of Pancreatic Duodenal Homeobox 1 DNA Improves Hyperglycemia and is Associated with Limited Complications in Diabetic mice. Endocr J. 2009 Jun 27.
Ref 537543Predicting the myelotoxicity of chemotherapy: the use of pretreatment O6-methylguanine-DNA methyltransferase determination in peripheral blood mononuclear cells. Melanoma Res. 2009 Jun 25.
Ref 537544Photoluminescence of CdTe nanocrystals modulated by methylene blue and DNA. A label-free luminescent signaling nanohybrid platform. Phys Chem Chem Phys. 2009 Jul 7;11(25):5062-9. Epub 2009 Mar 26.
Ref 537584E.coli DNA Adenine Methyltransferase: Intra-Site Processivity and Substrate-Induced Dimerization and Activation. Biochemistry. 2009 Jul 6.
Ref 537608Assessment of cell viability, lipid peroxidation and quantification of DNA fragmentation after the treatment of anticancerous drug mitomycin C and curcumin in cultured human blood lymphocytes. Exp Toxicol Pathol. 2009 Jul 14.
Ref 537657Resistance of Pseudomonas aeruginosa to cefsulodin: modification of penicillin-binding protein 3 and mapping of its chromosomal gene. J Antimicrob Chemother. 1990 Apr;25(4):513-23.
Ref 537664Drug-DNA binding specificity: binding of netropsin and distamycin to poly(d2NH2A-dT). Biopolymers. 1990;30(1-2):223-7.
Ref 537679Binding affinity for penicillin-binding protein 2a correlates with in vivo activity of beta-lactam antibiotics against methicillin-resistant Staphylococcus aureus. J Infect Dis. 1990 Sep;162(3):705-10.
Ref 53768231P NMR spectra of ethidium, quinacrine, and daunomycin complexes with poly(adenylic acid).poly(uridylic acid) RNA duplex and calf thymus DNA. Biochemistry. 1989 Apr 4;28(7):2804-12.
Ref 537684Reactivation of peptidoglycan synthesis in ether-permeabilized Escherichia coli after inhibition by beta-lactam antibiotics. Antimicrob Agents Chemother. 1989 Dec;33(12):2101-8.
Ref 537764Interactions of antitumor agents Ametantrone and Mitoxantrone (Novatrone) with double-stranded DNA. Biochem Pharmacol. 1985 Dec 15;34(24):4203-13.
Ref 537776Effects of piposulfan (Ancyte) on protein and DNA synthesis in Ehrlich ascites carcinoma. Life Sci II. 1971 Jun 8;10(11):605-12.
Ref 537784Bleomycin and talisomycin sequence-specific strand scission of DNA: a mechanism of double-strand cleavage. Cancer Res. 1982 Jul;42(7):2779-85.
Ref 537799Mechanisms of resistance to beta-lactam antibiotics in Staphylococcus aureus. Scand J Infect Dis Suppl. 1984;42:64-71.
Ref 537800Mutagenicity and carcinogenicity of methoxsalen plus UV-A. Arch Dermatol. 1984 May;120(5):662-9.
Ref 537802Affinity of cefonicid, a long-acting cephalosporin, for the penicillin-binding proteins of Escherichia coli K-12. J Antibiot (Tokyo). 1984 May;37(5):572-6.
Ref 537817Interaction of adriamycin with DNA as studied by resonance Raman spectroscopy. Nucleic Acids Res. 1982 Jun 25;10(12):3803-16.
Ref 537830Sequence-dependent effects in drug-DNA interaction: the crystal structure of Hoechst 33258 bound to the d(CGCAAATTTGCG)2 duplex. Nucleic Acids Res. 1994 May 11;22(9):1607-12.
Ref 537832Localization of penicillin-binding proteins to the splitting system of Staphylococcus aureus septa by using a mercury-penicillin V derivative. J Bacteriol. 1995 Jul;177(13):3631-40.
Ref 537898Crystal structure of a covalent DNA-drug adduct: anthramycin bound to C-C-A-A-C-G-T-T-G-G and a molecular explanation of specificity. Biochemistry. 1994 Nov 22;33(46):13593-610.
Ref 537909The formation of functional penicillin-binding proteins. J Biol Chem. 1975 Aug 25;250(16):6578-85.
Ref 537929Activities of antibiotics against methicillin-resistant Staphylococcus aureus with particular reference to synergetic effect between ticarcillin and fosfomycin on penicillinase non-producing methicillin-resistant S. aureus. Jpn J Antibiot. 1993 Jun;46(6):421-7.
Ref 537957On the nature of the adaptive response induced by mitomycin C in Vibrio cholerae OGAWA 154 cells. Biochem Biophys Res Commun. 1996 Mar 27;220(3):509-14.
Ref 537960Excision of DNA adducts of nitrogen mustards by bacterial and mammalian 3-methyladenine-DNA glycosylases. Carcinogenesis. 1996 Apr;17(4):643-8.
Ref 538053Defining GC-specificity in the minor groove: side-by-side binding of the di-imidazole lexitropsin to C-A-T-G-G-C-C-A-T-G. Structure. 1997 Aug 15;5(8):1033-46.
Ref 538061Penicillin-binding protein sensitive to cephalexin in sporulation of Bacillus cereus. Microbiol Res. 1997 Sep;152(3):227-32.
Ref 538071The impact of penicillinase on cefamandole treatment and prophylaxis of experimental endocarditis due to methicillin-resistant Staphylococcus aureus. J Infect Dis. 1998 Jan;177(1):146-54.
Ref 538101DNA interactions of a novel platinum drug, cis-[PtCl(NH3)2(N7-acyclovir)]+. Mol Pharmacol. 1998 May;53(5):846-55.
Ref 538144Clinical relevance of antibiotic-induced endotoxin release in patients undergoing hepatic resection. World J Surg. 1999 Jan;23(1):75-9.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.