Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T85250
|
||||
| Former ID |
TTDR01394
|
||||
| Target Name |
mRNA of human glycogen synthase kinase 3 alpha
|
||||
| Gene Name |
GSK3A
|
||||
| Synonyms |
GSK3 alpha (mRNA); GSK3A (mRNA); Glycogen synthase kinase3 alpha (mRNA); Serine/threonineprotein kinase GSK3A (mRNA); GSK3A
|
||||
| Target Type |
Research
|
||||
| Function |
Constitutively activeprotein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T85250
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.1
|
||||
| Sequence |
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT NSS |
||||
| Pathways | |||||
| KEGG Pathway | Chemokine signaling pathway | ||||
| Dopaminergic synapse | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| Insulin/IGF pathway-protein kinase B signaling cascade | |||||
| PDGF signaling pathway | |||||
| Ras Pathway | |||||
| Pathway Interaction Database | Degradation of beta catenin | ||||
| Canonical Wnt signaling pathway | |||||
| FOXM1 transcription factor network | |||||
| Class I PI3K signaling events mediated by Akt | |||||
| Reactome | AKT phosphorylates targets in the cytosol | ||||
| XBP1(S) activates chaperone genes | |||||
| Constitutive Signaling by AKT1 E17K in Cancer | |||||
| WikiPathways | Glycogen Metabolism | ||||
| Insulin Signaling | |||||
| Wnt Signaling Pathway Netpath | |||||
| Activation of Chaperone Genes by XBP1(S) | |||||
| T-Cell Receptor and Co-stimulatory Signaling | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| B Cell Receptor Signaling Pathway | |||||
| Leptin signaling pathway | |||||
| Integrated Breast Cancer Pathway | |||||
| SREBP signalling | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 526504 | J Med Chem. 2003 Jan 16;46(2):222-36.Aloisines, a new family of CDK/GSK-3 inhibitors. SAR study, crystal structure in complex with CDK2, enzyme selectivity, and cellular effects. | ||||
| Ref 526553 | Selective glycogen synthase kinase 3 inhibitors potentiate insulin activation of glucose transport and utilization in vitro and in vivo. Diabetes. 2003 Mar;52(3):588-95. | ||||
| Ref 526957 | Structural basis for the synthesis of indirubins as potent and selective inhibitors of glycogen synthase kinase-3 and cyclin-dependent kinases. J Med Chem. 2004 Feb 12;47(4):935-46. | ||||
