Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T63505
|
||||
| Former ID |
TTDNS00592
|
||||
| Target Name |
Proto-oncogene c-Abl
|
||||
| Gene Name |
ABL1
|
||||
| Synonyms |
Abelson murine leukemia viral oncogene homolog 1; Abelson tyrosine-protein kinase 1; Tyrosine-protein kinase ABL1; p150; Proto-oncogene tyrosine-protein kinase ABL1; Abl; C-ABL; ABL1
|
||||
| Target Type |
Successful
|
||||
| Disease | Advanced breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
| Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
| Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
| Bone disease; Chronic lymphocytic leukaemia; Metastatic hormone refractory prostate cancer [ICD9:185; ICD10: M00-M99, C91, C61] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Chronic myelogenous leukaemia [ICD9: 205.1; ICD10: C92.1] | |||||
| Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | |||||
| Glioma; Lung cancer; Prostate cancer; Solid tumours [ICD9: 140-199, 191, 210-229; ICD10: C00-C75, C71, C7A, C7B, D10-D36, D3A] | |||||
| Ischemia [ICD9: 459.89; ICD10: I99.8] | |||||
| Intestinal cancer; Myeloid leukemia [ICD9: 152, 153, 205; ICD10: C17, C18, C92] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Osteosarcoma; Hematological malignancies; Solid tumours [ICD9: 140-199, 140-239, 170, 200-209, 210-229; ICD10: C40-C41, C81-C86, D10-D36, D3A] | |||||
| Function |
Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9. Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage- induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin- associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T78144
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.2
|
||||
| Sequence |
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR |
||||
| Structure |
1AB2; 1ABL; 1AWO; 1BBZ; 1JU5; 1OPL; 1ZZP; 2ABL; 2E2B; 2F4J; 2FO0; 2G1T; 2G2F; 2G2H; 2G2I; 2GQG; 2HIW; 2HYY; 2HZ0; 2HZ4; 2HZI; 2O88; 2V7A; 3CS9; 3EG0; 3EG1; 3EG2; 3EG3; 3EGU; 3K2M; 3PYY; 3QRI; 3QRJ; 3QRK; 3T04; 3UE4; 3UYO; 4J9B; 4J9C; 4J9D; 4J9E; 4J9F; 4J9G; 4J9H; 4J9I; 4JJB; 4JJC; 4JJD
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Adenosine triphosphate | Drug Info | Approved | Dietary shortage | [536838] |
| Bosutinib | Drug Info | Approved | Advanced breast cancer | [525021], [541049] | |
| Dasatinib | Drug Info | Approved | Chronic myelogenous leukaemia | [528715], [536577], [541021], [551871] | |
| Imatinib | Drug Info | Approved | Chronic myelogenous leukaemia | [536294], [541030] | |
| Nilotinib | Drug Info | Approved | Chronic myelogenous leukaemia | [529282], [541038] | |
| Ponatinib | Drug Info | Approved | Acute lymphoblastic leukemia | [532210], [541188] | |
| SKI-758 | Drug Info | Approved | Ischemia | [532210], [551871] | |
| Imatinib | Drug Info | Phase 3 | Intestinal cancer; Myeloid leukemia | [536294], [541030] | |
| AN-019 | Drug Info | Phase 2 | Chronic myelogenous leukaemia | [549038] | |
| AZD0530 | Drug Info | Phase 2 | Osteosarcoma; Hematological malignancies; Solid tumours | [536957], [542701] | |
| Bafetinib | Drug Info | Phase 2 | Bone disease; Chronic lymphocytic leukaemia; Metastatic hormone refractory prostate cancer | [523198], [542828] | |
| Dasatinib | Drug Info | Phase 2 | Multiple myeloma | [536957], [541021] | |
| Flumatinib | Drug Info | Phase 2 | Chronic myelogenous leukaemia | [525279] | |
| Imatinib | Drug Info | Phase 2 | Glioma; Lung cancer; Prostate cancer; Solid tumours | [536294], [541030] | |
| NPB-001-056 | Drug Info | Phase 1/2 | Chronic myelogenous leukaemia | [549228] | |
| ABL 001 | Drug Info | Phase 1 | Leukemia | [549541] | |
| Adaphostin | Drug Info | Phase 1 | Chronic myelogenous leukaemia | [528231] | |
| DCC-2036 | Drug Info | Phase 1 | Acute lymphoblastic leukemia | [522553] | |
| KW-2449 | Drug Info | Phase 1 | Acute myeloid leukemia | [530222], [541033] | |
| MC-2001 | Drug Info | Preclinical | Leukemia | [548002] | |
| Inhibitor | (E)-4-(3,5-dimethoxystyryl)phenol | Drug Info | [528198] | ||
| 3'',5''-dimethoxy-[1,1':2',1'']-terphenyl-4-ol | Drug Info | [528198] | |||
| 3'',5''-dimethoxy-[1,1':3',1'']-terphenyl-4-ol | Drug Info | [528198] | |||
| 4,3'',5''-trimethoxy-[1,1':2',1'']-terphenyl | Drug Info | [528198] | |||
| 4,3'',5''-trimethoxy-[1,1':3',1'']-terphenyl | Drug Info | [528198] | |||
| 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | |||
| ABL 001 | Drug Info | [551798] | |||
| Adaphostin | Drug Info | [526238] | |||
| Adenosine triphosphate | Drug Info | [535436], [536557] | |||
| AG-1879 | Drug Info | [529296] | |||
| AN-019 | Drug Info | [532119] | |||
| AP-24163 | Drug Info | [530949] | |||
| AP-24226 | Drug Info | [530949] | |||
| BAS-00387275 | Drug Info | [528211] | |||
| BAS-00387328 | Drug Info | [528211] | |||
| BAS-00387347 | Drug Info | [528211] | |||
| BAS-00672722 | Drug Info | [528211] | |||
| BAS-01373578 | Drug Info | [528211] | |||
| BAS-0338872 | Drug Info | [529217] | |||
| BAS-0338876 | Drug Info | [529217] | |||
| BAS-09534324 | Drug Info | [528211] | |||
| Bis-(5-hydroxy-1H-indol-2-yl)-methanone | Drug Info | [528209] | |||
| Bosutinib | Drug Info | [536474] | |||
| Dasatinib | Drug Info | [536331], [536474], [536797] | |||
| Flumatinib | Drug Info | [532541] | |||
| Imatinib | Drug Info | [536474] | |||
| JNJ-10198409 | Drug Info | [527932] | |||
| MC-2001 | Drug Info | [526836] | |||
| MYRISTIC ACID | Drug Info | [551374] | |||
| NPB-001-056 | Drug Info | [531495] | |||
| ON-044580 | Drug Info | [531107] | |||
| PD-0166326 | Drug Info | [530497] | |||
| PD-0173955 | Drug Info | [528432] | |||
| PD-0173956 | Drug Info | [530497] | |||
| SKI-758 | Drug Info | [528584] | |||
| TG-100435 | Drug Info | [528527] | |||
| TRISMETHOXYRESVERATROL | Drug Info | [528198] | |||
| [1,1':2',1'']-terphenyl-4,3'',5''-triol | Drug Info | [528198] | |||
| Modulator | AZD0530 | Drug Info | |||
| Bafetinib | Drug Info | [1572591] | |||
| DCC-2036 | Drug Info | ||||
| Nilotinib | Drug Info | [529282] | |||
| Ponatinib | Drug Info | [551871] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | ErbB signaling pathway | ||||
| Ras signaling pathway | |||||
| Cell cycle | |||||
| Axon guidance | |||||
| Neurotrophin signaling pathway | |||||
| Pathogenic Escherichia coli infection | |||||
| Shigellosis | |||||
| Pathways in cancer | |||||
| MicroRNAs in cancer | |||||
| Chronic myeloid leukemia | |||||
| Viral myocarditis | |||||
| PANTHER Pathway | Axon guidance mediated by Slit/Robo | ||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| ATM pathway | |||||
| Regulation of Telomerase | |||||
| Posttranslational regulation of adherens junction stability and dissassembly | |||||
| Lissencephaly gene (LIS1) in neuronal migration and development | |||||
| PDGFR-beta signaling pathway | |||||
| Neurotrophic factor-mediated Trk receptor signaling | |||||
| Validated transcriptional targets of TAp63 isoforms | |||||
| p53 pathway | |||||
| Regulation of retinoblastoma protein | |||||
| Reactome | Regulation of actin dynamics for phagocytic cup formation | ||||
| CDO in myogenesis | |||||
| RHO GTPases Activate WASPs and WAVEs | |||||
| HDR through Single Strand Annealing (SSA) | |||||
| Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| WikiPathways | Apoptosis-related network due to altered Notch3 in ovarian cancer | ||||
| Fcgamma receptor (FCGR) dependent phagocytosis | |||||
| ATM Signaling Pathway | |||||
| Retinoblastoma (RB) in Cancer | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Pathogenic Escherichia coli infection | |||||
| Regulation of Microtubule Cytoskeleton | |||||
| Integrated Breast Cancer Pathway | |||||
| Signaling by Robo receptor | |||||
| Myogenesis | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| References | |||||
| Ref 522553 | ClinicalTrials.gov (NCT00827138) Study Safety and Preliminary Efficacy of DCC-2036 in Patients With Leukemias (Ph+ CML With T315I Mutation). U.S. National Institutes of Health. | ||||
| Ref 523198 | ClinicalTrials.gov (NCT01215799) Study of Bafetinib (INNO-406) as Treatment for Patients With Hormone-Refractory Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 525021 | ClinicalTrials.gov (NCT02311998) Phase I/II Study of Bosutinib in Combination With Inotuzumab Ozogamicin in CD22-positive Philadelphia-Chromosome (PC) Positive Acute Lymphoblastic Leukemia (ALL) and Chronic Myeloid Leukemia (CML). U.S. National Institutes of Health. | ||||
| Ref 525279 | ClinicalTrials.gov (NCT02511340) A Phase II Study to Evaluate the Efficacy and the Safety of Flumatinib in CML-AP or CML-BP Patients. | ||||
| Ref 530222 | KW-2449, a novel multikinase inhibitor, suppresses the growth of leukemia cells with FLT3 mutations or T315I-mutated BCR/ABL translocation. Blood. 2009 Aug 20;114(8):1607-17. | ||||
| Ref 536294 | Emerging treatments for pulmonary arterial hypertension. Expert Opin Emerg Drugs. 2006 Nov;11(4):609-19. | ||||
| Ref 536577 | Dasatinib: a tyrosine kinase inhibitor for the treatment of chronic myelogenous leukemia and philadelphia chromosome-positive acute lymphoblastic leukemia. Clin Ther. 2007 Nov;29(11):2289-308. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 536957 | Current and future treatments of bone metastases. Expert Opin Emerg Drugs. 2008 Dec;13(4):609-27. | ||||
| Ref 541021 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5678). | ||||
| Ref 541030 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5687). | ||||
| Ref 541033 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5691). | ||||
| Ref 541038 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5697). | ||||
| Ref 541049 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5710). | ||||
| Ref 541188 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5890). | ||||
| Ref 542701 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7731). | ||||
| Ref 542828 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7906). | ||||
| Ref 548002 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021088) | ||||
| Ref 549038 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031662) | ||||
| Ref 549228 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033940) | ||||
| Ref 526238 | Effects of the Bcr/abl kinase inhibitors STI571 and adaphostin (NSC 680410) on chronic myelogenous leukemia cells in vitro. Blood. 2002 Jan 15;99(2):664-71. | ||||
| Ref 526836 | Vascular endothelial growth factor and its receptors in multiple myeloma. Leukemia. 2003 Oct;17(10):1961-6. | ||||
| Ref 527932 | J Med Chem. 2005 Dec 29;48(26):8163-73.(6,7-Dimethoxy-2,4-dihydroindeno[1,2-c]pyrazol-3-yl)phenylamines: platelet-derived growth factor receptor tyrosine kinase inhibitors with broad antiproliferative activity against tumor cells. | ||||
| Ref 528198 | J Med Chem. 2006 May 18;49(10):3012-8.Identification of a terphenyl derivative that blocks the cell cycle in the G0-G1 phase and induces differentiation in leukemia cells. | ||||
| Ref 528209 | J Med Chem. 2006 Jun 1;49(11):3101-15.Novel bis(1H-indol-2-yl)methanones as potent inhibitors of FLT3 and platelet-derived growth factor receptor tyrosine kinase. | ||||
| Ref 528211 | J Med Chem. 2006 Jun 1;49(11):3278-86.A combination of docking/dynamics simulations and pharmacophoric modeling to discover new dual c-Src/Abl kinase inhibitors. | ||||
| Ref 528432 | J Med Chem. 2006 Sep 21;49(19):5759-68.Structural insights into the ATP binding pocket of the anaplastic lymphoma kinase by site-directed mutagenesis, inhibitor binding analysis, and homology modeling. | ||||
| Ref 528490 | J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. | ||||
| Ref 528527 | Bioorg Med Chem Lett. 2007 Feb 1;17(3):602-8. Epub 2006 Nov 7.Discovery of [7-(2,6-dichlorophenyl)-5-methylbenzo [1,2,4]triazin-3-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]amine--a potent, orally active Src kinase inhibitor with anti-tumor activity in preclinical assays. | ||||
| Ref 528584 | J Med Chem. 2006 Dec 28;49(26):7868-76.Synthesis and Src kinase inhibitory activity of a series of 4-[(2,4-dichloro-5-methoxyphenyl)amino]-7-furyl-3-quinolinecarbonitriles. | ||||
| Ref 529217 | Bioorg Med Chem Lett. 2008 Feb 1;18(3):1207-11. Epub 2007 Dec 4.Discovery and SAR of 1,3,4-thiadiazole derivatives as potent Abl tyrosine kinase inhibitors and cytodifferentiating agents. | ||||
| Ref 529296 | J Med Chem. 2008 Mar 13;51(5):1252-9. Epub 2008 Feb 8.Structure-based optimization of pyrazolo[3,4-d]pyrimidines as Abl inhibitors and antiproliferative agents toward human leukemia cell lines. | ||||
| Ref 530222 | KW-2449, a novel multikinase inhibitor, suppresses the growth of leukemia cells with FLT3 mutations or T315I-mutated BCR/ABL translocation. Blood. 2009 Aug 20;114(8):1607-17. | ||||
| Ref 530497 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6872-6. Epub 2009 Oct 23.Structure-activity relationships of 6-(2,6-dichlorophenyl)-8-methyl-2-(phenylamino)pyrido[2,3-d]pyrimidin-7-ones: toward selective Abl inhibitors. | ||||
| Ref 530949 | J Med Chem. 2010 Jun 24;53(12):4701-19.Discovery of 3-[2-(imidazo[1,2-b]pyridazin-3-yl)ethynyl]-4-methyl-N-{4-[(4-methylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl}benzamide (AP24534), a potent,orally active pan-inhibitor of breakpoint cluster region-abelson (BCR-ABL) kinase including the T315I gatekeeper mutant. | ||||
| Ref 531107 | A Non-ATP-Competitive Dual Inhibitor of JAK2 and BCR-ABL Kinases: Elucidation of a Novel Therapeutic Spectrum Based on Substrate Competitive Inhibition. Genes Cancer. 2010 Apr;1(4):331-45. | ||||
| Ref 531495 | NPB001-05 inhibits Bcr-Abl kinase leading to apoptosis of imatinib-resistant cells. Front Biosci (Elite Ed). 2011 Jun 1;3:1273-88. | ||||
| Ref 532119 | Design, synthesis and preclinical evaluation of NRC-AN-019. Int J Oncol. 2013 Jan;42(1):168-78. | ||||
| Ref 532541 | Flumatinib, a selective inhibitor of BCR-ABL/PDGFR/KIT, effectively overcomes drug resistance of certain KIT mutants. Cancer Sci. 2014 Jan;105(1):117-25. | ||||
| Ref 535436 | High frequency of point mutations clustered within the adenosine triphosphate-binding region of BCR/ABL in patients with chronic myeloid leukemia or Ph-positive acute lymphoblastic leukemia who develop imatinib (STI571) resistance. Blood. 2002 May 1;99(9):3472-5. | ||||
| Ref 536331 | Multi-target therapeutics: when the whole is greater than the sum of the parts. Drug Discov Today. 2007 Jan;12(1-2):34-42. Epub 2006 Nov 28. | ||||
| Ref 536474 | A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22. | ||||
| Ref 536557 | Targeted chronic myeloid leukemia therapy: Seeking a cure. Am J Health Syst Pharm. 2007 Dec 15;64(24 Suppl 15):S9-15. | ||||
| Ref 536797 | In vitro and clinical investigation of the relationship between CCR5 receptor occupancy and anti-HIV activity of Aplaviroc. J Clin Pharmacol. 2008 Oct;48(10):1179-88. Epub 2008 Aug 1. | ||||
| Ref 551798 | ABL001, a Potent Allosteric Inhibitor of BCR-ABL, Prevents Emergence of Resistant Disease When Administered in Combination with Nilotinib in an in Vivo Murine Model of Chronic Myeloid Leukemia, NorthBuilding, 2014, 120-125. | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
