Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T71266
|
||||
| Former ID |
TTDI02016
|
||||
| Target Name |
AKT3 protein kinase
|
||||
| Gene Name |
AKT3
|
||||
| Synonyms |
PKB gamma; Protein kinase B gamma; RAC-PK-gamma; RAC-gamma serine/threonine-protein kinase; STK-2; AKT3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Colorectal cancer; Lymphoma [ICD9:153, 154, 202.8, 208.9; ICD10: C18-C21, C81-C86] | |||||
| Colon cancer; Rectal cancer [ICD9: 153, 154; ICD10: C50] | |||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Inoperable and unresectable late-stage solid tumors [ICD9: 140-199, 210-229; ICD10: C00-C75, C7A, C7B, D10-D36, D3A] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
AKT3 is one of 3 closely related serine/threonine- protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. AKT3 is the least studied AKT isoform. It plays an important role in brain development and is crucial for the viability of malignant glioma cells. AKT3 isoform may also be the key molecule in up-regulation and down-regulation of MMP13 via IL13. Required for the coordination of mitochondrial biogenesis with growth factor-induced increases in cellular energy demands. Down-regulation by RNA interferencereduces the expression of the phosphorylated form of BAD, resulting in the induction of caspase- dependent apoptosis.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.1
|
||||
| Sequence |
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | AZD5363 | Drug Info | Phase 2 | Cancer | [524662], [542684] |
| GSK2141795 | Drug Info | Phase 2 | Colorectal cancer; Lymphoma | [524462], [542825] | |
| MK-2206 | Drug Info | Phase 2 | Colon cancer; Rectal cancer | [523269], [542860] | |
| Afuresertib | Drug Info | Phase 1 | Multiple myeloma | [524607], [542816] | |
| ARQ 092 | Drug Info | Phase 1 | Inoperable and unresectable late-stage solid tumors | [523692] | |
| BAY1125976 | Drug Info | Phase 1 | Cancer | [524391] | |
| GSK690693 | Drug Info | Phase 1 | Hematologic malignancies | [468252], [522304] | |
| LY2780301 | Drug Info | Phase 1 | Cancer | [523025] | |
| LYS-6KAKT1 | Drug Info | Phase 1 | Cancer | [549276] | |
| MSC2363318A | Drug Info | Phase 1 | Solid tumours | [524495] | |
| SR13668 | Drug Info | Phase 1 | Cancer | [522659] | |
| TCN-P | Drug Info | Phase 1 | Acute myeloid leukemia | [521869] | |
| XL418 | Drug Info | Phase 1 | Solid tumours | [522010] | |
| Modulator | Afuresertib | Drug Info | [532901] | ||
| ARQ 092 | Drug Info | [1572591] | |||
| AZD5363 | Drug Info | [532901] | |||
| BAY1125976 | Drug Info | [1572591] | |||
| GSK2141795 | Drug Info | [531478], [532865] | |||
| GSK690693 | Drug Info | ||||
| LY2780301 | Drug Info | [533217] | |||
| LYS-6KAKT1 | Drug Info | ||||
| MK-2206 | Drug Info | ||||
| MSC2363318A | Drug Info | [524495] | |||
| SR13668 | Drug Info | [530382], [531379] | |||
| TCN-P | Drug Info | ||||
| XL418 | Drug Info | ||||
| Inhibitor | Akt inhibitor VIII | Drug Info | [527396] | ||
| compound 1 | Drug Info | [530572] | |||
| ISC-4 | Drug Info | [543586] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| ErbB signaling pathway | |||||
| Ras signaling pathway | |||||
| Rap1 signaling pathway | |||||
| cGMP-PKG signaling pathway | |||||
| cAMP signaling pathway | |||||
| Chemokine signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| FoxO signaling pathway | |||||
| Sphingolipid signaling pathway | |||||
| mTOR signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| AMPK signaling pathway | |||||
| Apoptosis | |||||
| Adrenergic signaling in cardiomyocytes | |||||
| VEGF signaling pathway | |||||
| Osteoclast differentiation | |||||
| Focal adhesion | |||||
| Tight junction | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Platelet activation | |||||
| Toll-like receptor signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| T cell receptor signaling pathway | |||||
| B cell receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| Fc gamma R-mediated phagocytosis | |||||
| TNF signaling pathway | |||||
| Neurotrophin signaling pathway | |||||
| Cholinergic synapse | |||||
| Dopaminergic synapse | |||||
| Insulin signaling pathway | |||||
| Progesterone-mediated oocyte maturation | |||||
| Estrogen signaling pathway | |||||
| Prolactin signaling pathway | |||||
| Thyroid hormone signaling pathway | |||||
| Adipocytokine signaling pathway | |||||
| Glucagon signaling pathway | |||||
| Regulation of lipolysis in adipocytes | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Carbohydrate digestion and absorption | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| Colorectal cancer | |||||
| Renal cell carcinoma | |||||
| Pancreatic cancer | |||||
| Endometrial cancer | |||||
| Glioma | |||||
| Prostate cancer | |||||
| Melanoma | |||||
| Chronic myeloid leukemia | |||||
| Acute myeloid leukemia | |||||
| Small cell lung cancer | |||||
| Non-small cell lung cancer | |||||
| Central carbon metabolism in cancer | |||||
| Choline metabolism in cancer | |||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| PANTHER Pathway | Angiogenesis | ||||
| Apoptosis signaling pathway | |||||
| EGF receptor signaling pathway | |||||
| Endothelin signaling pathway | |||||
| FGF signaling pathway | |||||
| Huntington disease | |||||
| Hypoxia response via HIF activation | |||||
| Inflammation mediated by chemokine and cytokine signaling pathway | |||||
| Interleukin signaling pathway | |||||
| PI3 kinase pathway | |||||
| T cell activation | |||||
| p53 pathway | |||||
| Ras Pathway | |||||
| p53 pathway by glucose deprivation | |||||
| p53 pathway feedback loops 2 | |||||
| Pathway Interaction Database | S1P3 pathway | ||||
| Class I PI3K signaling events mediated by Akt | |||||
| References | |||||
| Ref 468252 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5196). | ||||
| Ref 521869 | ClinicalTrials.gov (NCT00363454) Phase I Study of Triciribine Phosphate Monohydrate (TCN-PM, VD-0002) in Adult Subjects With Metastatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 522010 | ClinicalTrials.gov (NCT00460278) Study of XL418 in Adults With Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 522304 | ClinicalTrials.gov (NCT00666081) Study to Investigate AKT Inhibitor GSK690693 in Subjects With Relapsed or Refractory Hematologic Malignancies. U.S. National Institutes of Health. | ||||
| Ref 522659 | ClinicalTrials.gov (NCT00896207) Studying Different Formulations of SR13668 in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 523025 | ClinicalTrials.gov (NCT01115751) A Study in Patients With Advanced or Metastatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 523269 | ClinicalTrials.gov (NCT01249105) MK-2206 for Recurrent Malignant Glioma. U.S. National Institutes of Health. | ||||
| Ref 523692 | ClinicalTrials.gov (NCT01473095) Phase 1 Dose Escalation Study of ARQ 092 in Adult Subjects With Advanced Solid Tumors and Recurrent Malignant Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 524391 | ClinicalTrials.gov (NCT01915576) Phase I Dose Escalation Study With an Allosteric AKT 1/2 Inhibitor in Patients. U.S. National Institutes of Health. | ||||
| Ref 524462 | ClinicalTrials.gov (NCT01958112) GSK1120212+GSK2141795 for Cervical Cancer. U.S. National Institutes of Health. | ||||
| Ref 524495 | ClinicalTrials.gov (NCT01971515) First-in-Human Dose Escalation Trial in Subjects With Advanced Malignancies. U.S. National Institutes of Health. | ||||
| Ref 524607 | ClinicalTrials.gov (NCT02040480) Bioavailability and Food Effect Study of Gelatin Formulation and Immediate Release Tablet Formulation of Afuresertib. U.S. National Institutes of Health. | ||||
| Ref 524662 | ClinicalTrials.gov (NCT02077569) AKT Inhibitor in Oestrogen Positive Breast Cancer. U.S. National Institutes of Health. | ||||
| Ref 542684 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7709). | ||||
| Ref 542816 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7890). | ||||
| Ref 542825 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7902). | ||||
| Ref 524495 | ClinicalTrials.gov (NCT01971515) First-in-Human Dose Escalation Trial in Subjects With Advanced Malignancies. U.S. National Institutes of Health. | ||||
| Ref 527396 | Allosteric Akt (PKB) inhibitors: discovery and SAR of isozyme selective inhibitors. Bioorg Med Chem Lett. 2005 Feb 1;15(3):761-4. | ||||
| Ref 530382 | Pharmacokinetics and enhanced bioavailability of candidate cancer preventative agent, SR13668 in dogs and monkeys. Cancer Chemother Pharmacol. 2010 May;65(6):1109-16. | ||||
| Ref 530572 | 2,3,5-Trisubstituted pyridines as selective AKT inhibitors. Part II: Improved drug-like properties and kinase selectivity from azaindazoles. Bioorg Med Chem Lett. 2010 Jan 15;20(2):679-83. | ||||
| Ref 531379 | Phase 0 clinical chemoprevention trial of the Akt inhibitor SR13668. Cancer Prev Res (Phila). 2011 Mar;4(3):347-53. | ||||
| Ref 531478 | Inhibiting the akt pathway in cancer treatment: three leading candidates. P T. 2011 Apr;36(4):225-7. | ||||
| Ref 532865 | Discovery of novel AKT inhibitors with enhanced anti-tumor effects in combination with the MEK inhibitor. PLoS One. 2014 Jun 30;9(6):e100880. | ||||
| Ref 532901 | The novel AKT inhibitor afuresertib shows favorable safety, pharmacokinetics, and clinical activity in multiple myeloma. Blood. 2014 Oct 2;124(14):2190-5. | ||||
| Ref 533217 | A first-in-human phase I trial of LY2780301, a dual p70 S6 kinase and Akt Inhibitor, in patients with advanced or metastatic cancer. Invest New Drugs. 2015 Jun;33(3):710-9. | ||||
