Target General Infomation
Target ID
T29960
Former ID
TTDR00688
Target Name
Wilms' tumor protein
Gene Name
WT1
Synonyms
WT1 protein; WT33; Wilms' tumour 1 protein; WT1
Target Type
Clinical Trial
Disease Acute myeloid leukemia [ICD9: 205; ICD10: C92.0]
Acute myeloid leukemia; Lung cancer [ICD9:205, 162; ICD10: C92.0, C33-C34]
Leukemia [ICD9: 208.9; ICD10: C90-C95]
Myeloid leukemia [ICD9: 208.9; ICD10: C92]
Function
Potential role in transcriptional regulation. Recognizes and binds to the dna sequence 5'-cgcccccgc-3'.
BioChemical Class
EGR C2H2-type zinc-finger
UniProt ID
Sequence
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA
SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED
PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV
RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC
ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS
CQKKFARSDELVRHHNMHQRNMTKLQLAL
Drugs and Mode of Action
Drug(s) Combined PR1/WT1 vaccine Drug Info Phase 2 Myeloid leukemia [533145]
DNA vaccine Drug Info Phase 2 Acute myeloid leukemia [523425]
FPI-01 Drug Info Phase 2 Acute myeloid leukemia [549553]
WT1 peptide vaccine Drug Info Phase 2 Leukemia [523307]
WT1-targeted autologous dendritic cell vaccine Drug Info Phase 2 Acute myeloid leukemia [524053]
WT-4869 Drug Info Phase 1/2 Leukemia [549182]
GSK-2130579A Drug Info Phase 1 Acute myeloid leukemia [522918]
INNO-305 Drug Info Phase 1 Acute myeloid leukemia; Lung cancer [548250]
Modulator INNO-305 Drug Info [548249]
WT-4869 Drug Info [549181]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Transcriptional misregulation in cancer
NetPath Pathway FSH Signaling Pathway
IL5 Signaling Pathway
Pathway Interaction Database p73 transcription factor network
Regulation of Telomerase
WikiPathways Primary Focal Segmental Glomerulosclerosis FSGS
Integrated Pancreatic Cancer Pathway
References
Ref 522918ClinicalTrials.gov (NCT01051063) Evaluation of a New Anti-cancer Immunotherapy in Adult Acute Myeloid Leukemia Patients With a Suboptimal Clinical Response to Induction Chemotherapy. U.S. National Institutes of Health.
Ref 523307ClinicalTrials.gov (NCT01266083) Trial of a WT-1 Analog Peptide Vaccine in Patients With Acute Myeloid Leukemia (AML) or Acute Lymphoblastic Leukemia (ALL). U.S. National Institutes of Health.
Ref 523425ClinicalTrials.gov (NCT01334060) WT1 Immunity Via DNA Fusion Gene Vaccination in Haematological Malignancies by Intramuscular Injection Followed by Intramuscular Electroporation. U.S. National Institutes of Health.
Ref 524053ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health.
Ref 533145Review of the Results of WT1 Peptide Vaccination Strategies for Myelodysplastic Syndromes and Acute Myeloid Leukemia from Nine Different Studies. Front Immunol. 2015 Feb 4;6:36.
Ref 548250Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753)
Ref 549182Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385)
Ref 549553Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040574)
Ref 524053ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health.
Ref 529050Leukemia-associated antigen-specific T-cell responses following combined PR1 and WT1 peptide vaccination in patients with myeloid malignancies. Blood. 2008 Jan 1;111(1):236-42. Epub 2007 Sep 17.
Ref 531614Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3beta sequence associated with remission in one patient is detectable in other vaccinated patients. Cancer ImmunolImmunother. 2012 Mar;61(3):313-22.
Ref 548249Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753)
Ref 549181Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385)
Ref 550079Spoilight on personalized medicine. A pharma matters report, Thomson Reuters, 2012.
Ref 550472National Cancer Institute Drug Dictionary (drug id 699216).
Ref 550785Clinical pipeline report, company report or official report of Formula Pharmaceuticals.