Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T31479
|
||||
| Former ID |
TTDS00065
|
||||
| Target Name |
Phospholipase A2
|
||||
| Gene Name |
PLA2G1B
|
||||
| Synonyms |
Group IB phospholipase A2; Phosphatidylcholine 2-acylhydrolase; Secreted phospholipase A(2); PLA2G1B
|
||||
| Target Type |
Successful
|
||||
| Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
| Asthma [ICD10: J45] | |||||
| Allergy [ICD9: 995.3; ICD10: T78.4] | |||||
| Arteriosclerosis [ICD9: 440; ICD10: I70] | |||||
| Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
| Contact dermatitis [ICD9: 692; ICD10: L23, L24, L25] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammatory and pruritic manifestations of moderate to severe corticosteroid-responsive dermatoses of the scalp [ICD10: L20-L30] | |||||
| Inflammatory and pruritic manifestations of corticosteroid responsive dermatoses [ICD10: L20-L30] | |||||
| Leishmaniasis [ICD10: B55.0] | |||||
| Nerve injury [ICD10: T14.4] | |||||
| Pruritus [ICD9: 698; ICD10: L29] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Visceral leishmaniasis [ICD9: 85; ICD10: B55.0] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules.
|
||||
| BioChemical Class |
Carboxylic ester hydrolase
|
||||
| Target Validation |
T31479
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.1.4
|
||||
| Sequence |
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC DRNAAICFSKAPYNKAHKNLDTKKYCQS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cholic Acid | Drug Info | Approved | Peroxisomal disorders; Synthesis disorders | [541327] |
| Clobetasol | Drug Info | Approved | Inflammatory and pruritic manifestations of moderate to severe corticosteroid-responsive dermatoses of the scalp | [551871] | |
| Clocortolone | Drug Info | Approved | Inflammatory and pruritic manifestations of moderate to severe corticosteroid-responsive dermatoses of the scalp | [551871] | |
| Diflorasone | Drug Info | Approved | Inflammatory and pruritic manifestations of corticosteroid responsive dermatoses | [551871] | |
| Miltefosine | Drug Info | Approved | Leishmaniasis | [533123] | |
| AllerB | Drug Info | Phase 2b | Allergy | [550258] | |
| MANOALIDE | Drug Info | Phase 2 | Arthritis | [531035] | |
| Miltefosine | Drug Info | Phase 2 | Visceral leishmaniasis | [537364] | |
| MRX-4 | Drug Info | Phase 2 | Allergic rhinitis | [548571] | |
| MRX-6 | Drug Info | Phase 2 | Contact dermatitis | [524592] | |
| Rilapladib | Drug Info | Phase 1 | Arteriosclerosis | [542396], [547694] | |
| Darapladib | Drug Info | Discontinued in Phase 3 | Arteriosclerosis | [541801], [547463] | |
| BMY-30129 | Drug Info | Discontinued in Phase 2 | Pruritus | [545846] | |
| EPC-K1 | Drug Info | Discontinued in Phase 2 | Nerve injury | [546374] | |
| SC-106 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [546279] | |
| WAY-123641 | Drug Info | Discontinued in Phase 2 | Asthma | [545618] | |
| PF-05212372 | Drug Info | Discontinued in Phase 1 | Asthma | [523586] | |
| SB-435495 | Drug Info | Discontinued in Phase 1 | Arteriosclerosis | [547355] | |
| YM-26734 | Drug Info | Terminated | Rheumatoid arthritis | [545954] | |
| Inhibitor | 2-Methyl-2,4-Pentanediol | Drug Info | [551393] | ||
| 3,9-dihydroxy-2,10-diprenylpterocap-6a-ene | Drug Info | [551368] | |||
| 4'-hydroxy-6,3',5'-triprenylisoflavonone | Drug Info | [551368] | |||
| ABYSSINONE V | Drug Info | [551368] | |||
| Acetate Ion | Drug Info | [551393] | |||
| AllerB | Drug Info | [534658] | |||
| Alpha-D-Mannose | Drug Info | [551393] | |||
| BM-162115 | Drug Info | [534587] | |||
| BMY-30129 | Drug Info | [533821], [551871] | |||
| BOLINAQUINONE | Drug Info | [526069] | |||
| CACOSPONGIONOLIDE | Drug Info | [534672] | |||
| CACOSPONGIONOLIDE B | Drug Info | [534672] | |||
| Cacospongionolide E | Drug Info | [534672] | |||
| Cholic Acid | Drug Info | [551393] | |||
| Clobetasol | Drug Info | [537809] | |||
| Diflorasone | Drug Info | [536938] | |||
| EPC-K1 | Drug Info | [533699], [551871] | |||
| HELENAQUINONE | Drug Info | [531037] | |||
| Heptanoic Acid | Drug Info | [551374] | |||
| Hexane-1,6-Diol | Drug Info | [551393] | |||
| HYRTIOSULAWESINE | Drug Info | [528597] | |||
| Lpc-Ether | Drug Info | [551393] | |||
| LY178002 | Drug Info | [537683] | |||
| Mepacrine | Drug Info | [536930] | |||
| Miltefosine | Drug Info | [537364] | |||
| MRX-4 | Drug Info | [551190] | |||
| MRX-6 | Drug Info | [528718] | |||
| N-Tridecanoic Acid | Drug Info | [551374] | |||
| P-Anisic Acid | Drug Info | [551393] | |||
| Petrosaspongiolide M | Drug Info | [528771] | |||
| Petrosaspongiolide P | Drug Info | [534632] | |||
| PF-05212372 | Drug Info | [533816] | |||
| Pyruvoyl Group | Drug Info | [551393] | |||
| SB-435495 | Drug Info | [532111] | |||
| SC-106 | Drug Info | [550919] | |||
| URSOLIC ACID | Drug Info | [527616] | |||
| WAY-123641 | Drug Info | [533904] | |||
| Modulator | AGN-190383 | Drug Info | |||
| Darapladib | Drug Info | [552985] | |||
| folipastatin | Drug Info | ||||
| MANOALIDE | Drug Info | ||||
| Rilapladib | Drug Info | ||||
| SB-203347 | Drug Info | ||||
| WA-8242-A1 | Drug Info | ||||
| YM-26734 | Drug Info | ||||
| Inducer | Clocortolone | Drug Info | [537815] | ||
| Binder | LY256548 | Drug Info | [537683] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Phospholipases | ||||
| KEGG Pathway | Glycerophospholipid metabolism | ||||
| Ether lipid metabolism | |||||
| Arachidonic acid metabolism | |||||
| Linoleic acid metabolism | |||||
| alpha-Linolenic acid metabolism | |||||
| Metabolic pathways | |||||
| Ras signaling pathway | |||||
| Vascular smooth muscle contraction | |||||
| Pancreatic secretion | |||||
| Fat digestion and absorption | |||||
| Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
| Reactome | Acyl chain remodelling of PC | ||||
| Acyl chain remodelling of PE | |||||
| Acyl chain remodelling of PI | |||||
| WikiPathways | Glycerophospholipid biosynthesis | ||||
| References | |||||
| Ref 523586 | ClinicalTrials.gov (NCT01415102) A First In Human Study In Healthy People To Evaluate Safety, Toleration And Time Course Of Plasma Concentration Of Single Inhaled Doses Of PF-05212372.. U.S. NationalInstitutes of Health. | ||||
| Ref 524592 | ClinicalTrials.gov (NCT02031445) Double-Blind, Trial to Evaluate the Safety and Efficacy of MRX-6 Cream 2%. U.S. National Institutes of Health. | ||||
| Ref 531035 | In situ aquaculture methods for Dysidea avara (Demospongiae, Porifera) in the northwestern Mediterranean. Mar Drugs. 2010 May 26;8(6):1731-42. | ||||
| Ref 537364 | Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7. | ||||
| Ref 541327 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 609). | ||||
| Ref 541801 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6696). | ||||
| Ref 542396 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7376). | ||||
| Ref 545618 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003918) | ||||
| Ref 545846 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005019) | ||||
| Ref 545954 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005488) | ||||
| Ref 546279 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007225) | ||||
| Ref 546374 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007770) | ||||
| Ref 547355 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015443) | ||||
| Ref 547463 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016591) | ||||
| Ref 547694 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018454) | ||||
| Ref 526069 | J Nat Prod. 2001 May;64(5):612-5.New sesquiterpene derivatives from the sponge Dysidea species with a selective inhibitor profile against human phospholipase A2 and other leukocyte functions. | ||||
| Ref 527616 | Bioorg Med Chem Lett. 2005 Sep 15;15(18):4100-4.Synthesis of benzoyl phenyl benzoates as effective inhibitors for phospholipase A2 and hyaluronidase enzymes. | ||||
| Ref 528597 | J Nat Prod. 2006 Dec;69(12):1676-9.Hyrtiazepine, an azepino-indole-type alkaloid from the Red Sea marine sponge Hyrtios erectus. | ||||
| Ref 528718 | A novel treatment of contact dermatitis by topical application of phospholipase A2 inhibitor: a double-blind placebo-controlled pilot study. Int J Immunopathol Pharmacol. 2007 Jan-Mar;20(1):191-5. | ||||
| Ref 528771 | J Med Chem. 2007 May 3;50(9):2176-84. Epub 2007 Apr 4.Synthesis and pharmacological evaluation of a selected library of new potential anti-inflammatory agents bearing the gamma-hydroxybutenolide scaffold: a new class of inhibitors of prostanoid production through the selective modulation of microsomal prostaglandin E synthase-1 expression. | ||||
| Ref 531037 | Bioorg Med Chem. 2010 Aug 15;18(16):6006-11. Epub 2010 Jun 25.New bioactive halenaquinone derivatives from South Pacific marine sponges of the genus Xestospongia. | ||||
| Ref 532111 | The effect of lipoprotein-associated phospholipase A2 deficiency on pulmonary allergic responses in Aspergillus fumigatus sensitized mice. Respir Res. 2012 Nov 12;13:100. | ||||
| Ref 533699 | Posttreatment with EPC-K1, an inhibitor of lipid peroxidation and of phospholipase A2 activity, reduces functional deficits after global ischemia in rats. Brain Res Bull. 1995;36(3):257-60. | ||||
| Ref 533816 | Phagedena due to leishmaniasis. Immunologic and experimental studies. Ann Dermatol Syphiligr (Paris). 1976;103(1):23-30. | ||||
| Ref 533821 | Inhibitor of phospholipase A2 blocks eicosanoid and platelet activating factor biosynthesis and has topical anti-inflammatory activity. J Pharmacol Exp Ther. 1994 Nov;271(2):852-9. | ||||
| Ref 533904 | Phosphodiesterase-IV inhibition, respiratory muscle relaxation and bronchodilation by WAY-PDA-641. J Pharmacol Exp Ther. 1994 Feb;268(2):888-96. | ||||
| Ref 534587 | Investigation on the effect of experimental phospholipase A2 inhibitors on the formyl-methionyl-leucyl-phenylalanine-stimulated chemotaxis of human leukocytes in vitro. Arzneimittelforschung. 1998 Jan;48(1):77-81. | ||||
| Ref 534632 | J Nat Prod. 1998 May;61(5):571-5.Petrosaspongiolides M-R: new potent and selective phospholipase A2 inhibitors from the New Caledonian marine sponge Petrosaspongia nigra. | ||||
| Ref 534658 | Successful immunotherapy with T-cell epitope peptides of bee venom phospholipase A2 induces specific T-cell anergy in patients allergic to bee venom. J Allergy Clin Immunol. 1998 Jun;101(6 Pt 1):747-54. | ||||
| Ref 534672 | J Nat Prod. 1998 Jul;61(7):931-5.A new cacospongionolide inhibitor of human secretory phospholipase A2 from the Tyrrhenian sponge Fasciospongia cavernosa and absolute configuration of cacospongionolides. | ||||
| Ref 536930 | Involvement of protein kinase C activation in L-leucine-induced stimulation of protein synthesis in l6 myotubes. Cytotechnology. 2003 Nov;43(1-3):97-103. | ||||
| Ref 536938 | Structures from powders: diflorasone diacetate. Steroids. 2009 Jan;74(1):102-11. Epub 2008 Oct 18. | ||||
| Ref 537364 | Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7. | ||||
| Ref 537683 | The anti-inflammatory effects of LY178002 and LY256548. Agents Actions. 1989 Jun;27(3-4):300-2. | ||||
| Ref 537809 | Utilization of epidermal phospholipase A2 inhibition to monitor topical steroid action. Br J Dermatol. 1984 Jul;111 Suppl 27:195-203. | ||||
| Ref 537815 | Clocortolone pivalate: a paired comparison clinical trial of a new topical steroid in eczema/atopic dermatitis. Cutis. 1980 Jan;25(1):96-8. | ||||
| Ref 551190 | Phospholipase A2, group IVA (cytosolic, calcium-dependent) (PLA2G4A). SciBX 1(41); doi:10.1038/scibx.2008.999. Nov. 13 2008 | ||||
| Ref 551368 | Phospholipase A2 Inhibitors from an Erythrina Species from Samoa J. Nat. Prod. 60(6):537-539 (1997). | ||||
