Target General Infomation
Target ID
T31992
Former ID
TTDR00213
Target Name
Carbonic anhydrase XIV
Gene Name
CA14
Synonyms
CA-XIV; Carbonate dehydratase XIV; UNQ690/PRO1335; CA14
Target Type
Successful
Disease Breast cancer [ICD9: 174, 175; ICD10: C50]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Inborn error of metabolism [ICD10: E88.9]
Function
Reversible hydration of carbon dioxide.
BioChemical Class
Carbon-oxygen lyases
Target Validation
T31992
UniProt ID
EC Number
EC 4.2.1.1
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Drugs and Mode of Action
Drug(s) MAFENIDE Drug Info Approved Bacterial infection [530765]
TRIENTINE Drug Info Approved Inborn error of metabolism [551871]
Curcumin Drug Info Phase 3 Cancer [532348], [542031]
PARABEN Drug Info Phase 3 Discovery agent [524059]
PHENOL Drug Info Phase 2/3 Discovery agent [525296]
COUMATE Drug Info Phase 2 Breast cancer [531371]
SPERMINE Drug Info Terminated Discovery agent [542107], [546483]
Inhibitor 2,3-dihydro-1H-indene-5-sulfonamide Drug Info [529417]
2,4-Disulfamyltrifluoromethylaniline Drug Info [527654]
2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid Drug Info [529417]
2-amino-2,3-dihydro-1H-indene-5-sulfonamide Drug Info [529417]
2-Amino-benzenesulfonamide Drug Info [527654]
2-Amino-indan-5-sulfonic acid Drug Info [529417]
2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
2-oxo-2H-thiochromene-3-carboxylic acid Drug Info [530514]
3-Amino-benzenesulfonamide Drug Info [527654]
4,4'-thiodipyridine-3-sulfonamide Drug Info [530766]
4-(2-Amino-ethyl)-benzenesulfonamide Drug Info [527654]
4-(2-Hydroxy-ethyl)-benzenesulfonamide Drug Info [527654]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide Drug Info [530766]
4-(2-Propynylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide Drug Info [530766]
4-(Allylamino)-3-pyridinesulfonamide Drug Info [530766]
4-(Carbamolymethylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(Cyanomethylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(hydroxymethyl)benzenesulfonamide Drug Info [527654]
4-(Methylhydrazino)-3-pyridinesulfonamide Drug Info [530766]
4-(Quinolinoxy)-3-pyridinesulfonamide Drug Info [530766]
4-Amino-3-bromo-benzenesulfonamide Drug Info [527654]
4-Amino-3-chloro-benzenesulfonamide Drug Info [527654]
4-Amino-3-fluoro-benzenesulfonamide Drug Info [527654]
4-Amino-3-iodo-benzenesulfonamide Drug Info [527654]
4-AMINOPHENOL Drug Info [529562]
4-Benzythiopyridine-3-sulfonamide Drug Info [530766]
4-Ethoxy-3-pyridinesulfonamide Drug Info [530766]
4-Hydrazino-3-pyridinesulfonamide Drug Info [530766]
4-Hydrazino-benzenesulfonamide Drug Info [527654]
4-Methylthiopyridine-3-sulfonamide Drug Info [530766]
5-amino-1,3,4-thiadiazole-2-sulfonamide Drug Info [531013]
6-(aminomethyl)-2H-chromen-2-one Drug Info [530514]
6-(hydroxymethyl)-2H-chromen-2-one Drug Info [530514]
6-Hydroxy-benzothiazole-2-sulfonic acid amide Drug Info [527654]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
7-(benzyloxy)-2H-chromen-2-one Drug Info [530514]
7-butoxy-2H-chromen-2-one Drug Info [530514]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid Drug Info [530514]
7-phenethoxy-2H-chromen-2-one Drug Info [530514]
7-propoxy-2H-chromen-2-one Drug Info [530514]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
BENZOLAMIDE Drug Info [527654]
Beta-D-Mannose Drug Info [551393]
Carzenide Drug Info [527654]
CATECHIN Drug Info [531068]
COUMARIN Drug Info [530514]
COUMATE Drug Info [529605]
Curcumin Drug Info [531068]
Decane-1,10-diyl disulfamate Drug Info [530359]
Decyl sulfamate Drug Info [530359]
ELLAGIC ACID Drug Info [530751]
ETHOXYCOUMARIN Drug Info [530514]
Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate Drug Info [530514]
FERULIC ACID Drug Info [530751]
GALLICACID Drug Info [530751]
HERNIARIN Drug Info [530514]
Hexane-1,6-diamine Drug Info [530998]
MAFENIDE Drug Info [527654]
N-propynyl amidebenzenesulphonide Drug Info [528574]
N1-(2-aminoethyl)ethane-1,2-diamine Drug Info [530998]
N1-(naphthalen-1-yl)ethane-1,2-diamine Drug Info [530998]
Octane-1,8-diyl disulfamate Drug Info [530359]
Octyl sulfamate Drug Info [530359]
P-Coumaric Acid Drug Info [530751]
PARABEN Drug Info [530751]
Pentane-1,5-diamine Drug Info [530998]
PHENOL Drug Info [531068]
Prop-2-ynyl 4-sulfamoylbenzoate Drug Info [528574]
RESORCINOL Drug Info [529562]
SPERMINE Drug Info [530998]
Syringic Acid Drug Info [530751]
TRIENTINE Drug Info [530998]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Nitrogen metabolism
Reactome Reversible hydration of carbon dioxide
WikiPathways Reversible Hydration of Carbon Dioxide
References
Ref 524059ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health.
Ref 525296ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa.
Ref 530765J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases.
Ref 531371Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83.
Ref 532348Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68.
Ref 542031(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000).
Ref 542107(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 710).
Ref 546483Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008464)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 527654Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides.
Ref 528574Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92. Epub 2006 Nov 17.Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides.
Ref 529417Eur J Med Chem. 2008 Dec;43(12):2853-60. Epub 2008 Feb 29.Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation.
Ref 529562Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid.
Ref 529605Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies.
Ref 530359J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors.
Ref 530514J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins.
Ref 530751Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids.
Ref 530766Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides.
Ref 530998J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule.
Ref 531013Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamideresides in a less utilized binding pocket than most hydrophobic inhibitors.
Ref 531068Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.