Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T37539
|
||||
| Former ID |
TTDS00480
|
||||
| Target Name |
B-cell receptor CD22
|
||||
| Gene Name |
CD22
|
||||
| Synonyms |
B-lymphocyte cell adhesion molecule; BL-CAM; Leu-14; Sialic acid-binding Ig-like lectin 2; Siglec-2; CD22
|
||||
| Target Type |
Successful
|
||||
| Disease | Aggressive non-hodgkin's lymphoma [ICD9: 200, 201, 202, 202.8, 208.9; ICD10: C81, C81-C86, C82-C85, C91-C95] | ||||
| Autoimmune diabetes [ICD10: E08-E13] | |||||
| Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Haematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Lyme disease [ICD9: 88.81; ICD10: A69.2] | |||||
| Non-hodgkin's lymphoma; Diffuse large B-cell lymphoma [ICD9: 200, 200.0, 202; ICD10: C82-C85, C83.3] | |||||
| Systemic lupus erythematosus; Graft rejection in heart transplantation [ICD9: 695, 710.0, 996; ICD10: L51-L54, M32, T86] | |||||
| Function |
Mediates b-cell b-cell interactions. May be involvedin the localization of b-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is cd45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can bemasked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of b-cell antigen receptor signaling. Plays a role in positive regulation through interaction with src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their sh2 domains that block signal transduction through dephosphorylation of signaling molecules.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| Target Validation |
T37539
|
||||
| UniProt ID | |||||
| Sequence |
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV DYVILKH |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Inotuzumab ozogamicin | Drug Info | Approved | Acute lymphoblastic leukemia | [543021], [547545] |
| OspA lipoprotein | Drug Info | Approved | Lyme disease | [536381] | |
| Epratuzumab | Drug Info | Phase 3 | Systemic lupus erythematosus; Graft rejection in heart transplantation | [537129], [542963] | |
| BL-22 | Drug Info | Phase 2 | Acute lymphoblastic leukemia | [522698] | |
| Anti-CD22 | Drug Info | Phase 1 | Hematologic malignancies | [551667] | |
| Combotox | Drug Info | Phase 1 | Leukemia | [548715] | |
| Moxetumomab pasudotox | Drug Info | Phase 1 | Haematological malignancies | [551581] | |
| Targeted ranpirnase conjugates | Drug Info | Preclinical | Cancer | [548045] | |
| DCDT-2980S | Drug Info | Discontinued in Phase 2 | Non-hodgkin's lymphoma; Diffuse large B-cell lymphoma | [548683] | |
| RG7593 | Drug Info | Discontinued in Phase 2 | Hematological malignancies | [548683] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Hematopoietic cell lineage | |||||
| B cell receptor signaling pathway | |||||
| PANTHER Pathway | B cell activation | ||||
| Pathway Interaction Database | BCR signaling pathway | ||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
| WikiPathways | B Cell Receptor Signaling Pathway | ||||
| References | |||||
| Ref 522698 | ClinicalTrials.gov (NCT00924040) Retreatment Protocol for BL22 Immunotherapy in Relapsed or Refractory Hairy Cell Leukemia. U.S. National Institutes of Health. | ||||
| Ref 536381 | Infection of mice with lyme disease spirochetes constitutively producing outer surface proteins a and B. Infect Immun. 2007 Jun;75(6):2786-94. Epub 2007 Mar 19. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 542963 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8088). | ||||
| Ref 543021 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8266). | ||||
| Ref 547545 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017171) | ||||
| Ref 548045 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021480) | ||||
| Ref 548683 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027651) | ||||
| Ref 548715 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936) | ||||
| Ref 525761 | Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8. | ||||
| Ref 530776 | Anti-CD22 immunotoxin RFB4(dsFv)-PE38 (BL22) for CD22-positive hematologic malignancies of childhood: preclinical studies and phase I clinical trial. Clin Cancer Res. 2010 Mar 15;16(6):1894-903. | ||||
| Ref 531663 | Antibody fusion proteins: anti-CD22 recombinant immunotoxin moxetumomab pasudotox. Clin Cancer Res. 2011 Oct 15;17(20):6398-405. | ||||
| Ref 532335 | Results of inotuzumab ozogamicin, a CD22 monoclonal antibody, in refractory and relapsed acute lymphocytic leukemia. Cancer. 2013 Aug 1;119(15):2728-36. | ||||
| Ref 534840 | Safety and immunogenicity of recombinant Bacille Calmette-Gu?|rin (rBCG) expressing Borrelia burgdorferi outer surface protein A (OspA) lipoprotein in adult volunteers: a candidate Lyme disease vaccine. Vaccine. 1999 Feb 26;17(7-8):904-14. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 543710 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2786). | ||||
