Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T38179
|
||||
| Former ID |
TTDS00228
|
||||
| Target Name |
Beta-lactamase
|
||||
| Gene Name |
blaZ
|
||||
| Synonyms |
Cephalosporinase; blaZ
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
| Infections [ICD9: 001-139; ICD10: A00-B99] | |||||
| Multidrug resistant infection [ICD10: A00-B99] | |||||
| Methicillin-resistant staphylococcus aureus infection [ICD10: B95.62] | |||||
| Otitis media [ICD10: H65-H67] | |||||
| Serious infections [ICD9: 001-139; ICD10: A00-B99] | |||||
| Streptococcus pneumoniae infection [ICD10: J13] | |||||
| Toxicity [ICD10: T36-T50, T51-T65] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
This protein is a serine beta-lactamase with a substrate specificity for cephalosporins.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| Target Validation |
T38179
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.2.6
|
||||
| Sequence |
MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFA
YASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTY SDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKT LNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAF VYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ceftolozane/tazobactam | Drug Info | Approved | Unspecified | [551871] |
| Clavulanate | Drug Info | Approved | Bacterial infections | [538214] | |
| Tazobactam | Drug Info | Approved | Bacterial infections | [536361] | |
| CAZ AVI | Drug Info | Phase 3 | Serious infections | [523980] | |
| CXL | Drug Info | Phase 2 | Methicillin-resistant staphylococcus aureus infection | [550289] | |
| MK-7655 | Drug Info | Phase 2 | Bacterial infections | [550004] | |
| ME-1071 | Drug Info | Phase 1 | Bacterial infections | [548621] | |
| RASV-Sp | Drug Info | Phase 1 | Streptococcus pneumoniae infection | [544359] | |
| 2085-P | Drug Info | Discontinued in Phase 3 | Otitis media | [544827] | |
| DA-7101 | Drug Info | Discontinued in Phase 3 | Gram-positive bacterial infection | [536094] | |
| P1A | Drug Info | Discontinued in Phase 2 | Toxicity | [547883] | |
| BRL-42715 | Drug Info | Terminated | Bacterial infections | [544791] | |
| CL-186659 | Drug Info | Terminated | Bacterial infections | [545772] | |
| Ro-48-1220 | Drug Info | Terminated | Bacterial infections | [545783] | |
| Ro-48-5545 | Drug Info | Terminated | Bacterial infections | [546440] | |
| Ro-48-8724 | Drug Info | Terminated | Multidrug resistant infection | [546449] | |
| SB-236049 | Drug Info | Terminated | Bacterial infections | [526339] | |
| Inhibitor | (P-Iodophenylacetylamino)Methylphosphinic Acid | Drug Info | [551393] | ||
| 1-Aminopropane-1,2,3-tricarboxylic acid | Drug Info | [530163] | |||
| 2-(N-Morpholino)-Ethanesulfonic Acid | Drug Info | [551393] | |||
| 2-(Sulfanylmethyl)phenylphosphonic acid | Drug Info | [530954] | |||
| 2-mercaptophenylphosphonic acid | Drug Info | [530954] | |||
| 2-Methyl-2,4-Pentanediol | Drug Info | [551393] | |||
| 2-phenyl-1H-imidazole-4-carboxylic acid | Drug Info | [551374] | |||
| 3-Amino-3-(methoxycarbonyl)-1,5-pentandioic acid | Drug Info | [530163] | |||
| 3-ethoxycarbonylpyroglutamate | Drug Info | [530163] | |||
| 3-Nitrophenylboronic Acid | Drug Info | [551393] | |||
| 4,4'-Biphenyldiboronic Acid | Drug Info | [551393] | |||
| 4-(Carboxyvin-2-Yl)Phenylboronic Acid | Drug Info | [551393] | |||
| 4-Carboxyphenylboronic Acid | Drug Info | [551393] | |||
| 4-iodo-acetamido phenylboronic acid | Drug Info | [551393] | |||
| 4-Methyl-3-(2-oxo-azetidin-1-yl)-benzoic acid | Drug Info | [533436] | |||
| 4-[(METHYLSULFONYL)AMINO]BENZOIC ACID | Drug Info | [551374] | |||
| 5-Fluoro-2-sulfanyl-phenylphosphonic acid | Drug Info | [530954] | |||
| 5-hydroxymethylbenzo[b]thiophen-2-ylboronic acid | Drug Info | [529114] | |||
| 5-methyl-benzo[b]thiophen-2-ylboronic acid | Drug Info | [529114] | |||
| Acetate Ion | Drug Info | [551393] | |||
| Acylated Ceftazidime | Drug Info | [551393] | |||
| Alpha-Sulfanyl(2,4-dichlorobenzyl)phosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanyl(2-methoxybenzyl)phosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanyl(4-bromobenzyl)phosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanyl(4-chlorobenzyl)phosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanyl(4-fluorobenzyl)phosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanylbenzylphosphonic acid | Drug Info | [530954] | |||
| Alpha-Sulfanylpropylphosphonic acid | Drug Info | [530954] | |||
| Benzo[b]thiophen-2-ylboronic acid | Drug Info | [529114] | |||
| Benzo[B]Thiophene-2-Boronic Acid | Drug Info | [551393] | |||
| BRL-42715 | Drug Info | [533347] | |||
| Carbamic Acid | Drug Info | [551393] | |||
| Clavulanate | Drug Info | [537436] | |||
| Clavulanate+Amoxicillin | Drug Info | [536222] | |||
| DA-7101 | Drug Info | [536094] | |||
| Degraded Cephaloridine | Drug Info | [551393] | |||
| Diisopropyl 1-mercaptopropylphosphonate | Drug Info | [530954] | |||
| Diisopropyl 2-(sulfanylmethyl)phenylphosphonate | Drug Info | [530954] | |||
| Diisopropyl mercapto(phenyl)methylphosphonate | Drug Info | [530954] | |||
| Hydrolyzed Cephalothin | Drug Info | [551393] | |||
| M-Aminophenylboronic Acid | Drug Info | [551393] | |||
| ME-1071 | Drug Info | [532264] | |||
| MK-7655 | Drug Info | [532629] | |||
| N-2-Thiophen-2-Yl-Acetamide Boronic Acid | Drug Info | [551393] | |||
| PCNOTAXIME GROUP | Drug Info | [551374] | |||
| Ro-48-5545 | Drug Info | [534491] | |||
| SB-236049 | Drug Info | [526339] | |||
| Sucrose | Drug Info | [551403] | |||
| Tazobactam | Drug Info | [537578] | |||
| Thiophene-2-ylboronic acid | Drug Info | [529114] | |||
| Tribenzyl 2-aminopropane-1,2,3-tricarboxylate | Drug Info | [530163] | |||
| Triethyl 2-aminopropane-1,2,3-tricarboxylate | Drug Info | [530163] | |||
| [[N-(Benzyloxycarbonyl)Amino]Methyl]Phosphate | Drug Info | [551393] | |||
| Modulator | 2085-P | Drug Info | [550886] | ||
| CAZ AVI | Drug Info | [531904] | |||
| Ceftolozane/tazobactam | Drug Info | [533123] | |||
| CL-186659 | Drug Info | [550886] | |||
| CXL | Drug Info | [551120] | |||
| P1A | Drug Info | [530289] | |||
| Ro-48-1220 | Drug Info | [526280] | |||
| Ro-48-8724 | Drug Info | [534754] | |||
| References | |||||
| Ref 523980 | ClinicalTrials.gov (NCT01644643) Ceftazidime-Avibactam for the Treatment of Infections Due to Ceftazidime Resistant Pathogens. U.S. National Institutes of Health. | ||||
| Ref 526339 | Identification of a series of tricyclic natural products as potent broad-spectrum inhibitors of metallo-beta-lactamases. Antimicrob Agents Chemother. 2002 Jun;46(6):1880-6. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 538214 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065063. | ||||
| Ref 544359 | Rapid, Sensitive Recovery of Recombinant Attenuated Salmonella enterica Serovar Typhi Vaccine Strains from Human Blood. Clin Vaccine Immunol. 2013 September; 20(9): 1473-1478. | ||||
| Ref 544791 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001128) | ||||
| Ref 544827 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001248) | ||||
| Ref 545772 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004648) | ||||
| Ref 545783 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004684) | ||||
| Ref 546440 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008139) | ||||
| Ref 546449 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008187) | ||||
| Ref 547883 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020134) | ||||
| Ref 526280 | Comparative in vitro activity of apalcillin alone and combined with Ro 48-1220, a novel penam beta-lactamase inhibitor. Clin Microbiol Infect. 1995 Feb;1(2):86-100. | ||||
| Ref 526339 | Identification of a series of tricyclic natural products as potent broad-spectrum inhibitors of metallo-beta-lactamases. Antimicrob Agents Chemother. 2002 Jun;46(6):1880-6. | ||||
| Ref 529114 | J Med Chem. 2007 Nov 15;50(23):5644-54. Epub 2007 Oct 23.Optimizing cell permeation of an antibiotic resistance inhibitor for improved efficacy. | ||||
| Ref 530163 | Bioorg Med Chem Lett. 2009 Jul 1;19(13):3593-7. Epub 2009 May 6.Discovery of novel lipophilic inhibitors of OXA-10 enzyme (class D beta-lactamase) by screening amino analogs and homologs of citrate and isocitrate. | ||||
| Ref 530289 | IPSAT P1A, a class A beta-lactamase therapy for the prevention of penicillin-induced disruption to the intestinal microflora. Curr Opin Investig Drugs. 2009 Aug;10(8):838-44. | ||||
| Ref 530954 | J Med Chem. 2010 Jul 8;53(13):4862-76.Mercaptophosphonate compounds as broad-spectrum inhibitors of the metallo-beta-lactamases. | ||||
| Ref 531904 | NXL104 irreversibly inhibits the beta-lactamase from Mycobacterium tuberculosis. Biochemistry. 2012 Jun 5;51(22):4551-7. Epub 2012 May 22. | ||||
| Ref 532264 | Multidrug-resistant Gram-negative bacterial infections: are you ready for the challenge. Curr Clin Pharmacol. 2014 Feb;9(1):27-38. | ||||
| Ref 532629 | Discovery of MK-7655, a beta-lactamase inhibitor for combination with Primaxin?. Bioorg Med Chem Lett. 2014 Feb 1;24(3):780-5. | ||||
| Ref 533347 | In vitro evaluation of BRL 42715, a novel beta-lactamase inhibitor. Antimicrob Agents Chemother. 1989 Sep;33(9):1580-7. | ||||
| Ref 533436 | J Med Chem. 1988 Feb;31(2):370-4.N-aryl 3-halogenated azetidin-2-ones and benzocarbacephems, inhibitors of beta-lactamases. | ||||
| Ref 534491 | Potentiation of beta-lactams against Pseudomonas aeruginosa strains by Ro 48-1256, a bridged monobactam inhibitor of AmpC beta-lactamases. J Antimicrob Chemother. 1997 Sep;40(3):335-43. | ||||
| Ref 534754 | Activity of a broad-spectrum cephalosporin (Ro 48-8391) alone and in combination with two novel beta-lactamase inhibitors (Ro 48-5545 and Ro 48-8724). Diagn Microbiol Infect Dis. 1998 Oct;32(2):85-94. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 536222 | Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64. | ||||
| Ref 537436 | A sensitive coupled HPLC/electrospray mass spectrometry assay for SPM-1 metallo-beta-lactamase inhibitors. Assay Drug Dev Technol. 2009 Apr;7(2):170-9. | ||||
| Ref 537578 | Selection of TNF-alpha binding affibody molecules using a beta-lactamase protein fragment complementation assay. N Biotechnol. 2009 Jul 1. | ||||
| Ref 550148 | WO patent application no. 2010,0456,20, Recombinant bacterium capable of eliciting an immune response against streptococcus pneumoniae. | ||||
