Target General Infomation
Target ID
T47863
Former ID
TTDR00765
Target Name
Tumor-associated calcium signal transducer 1
Gene Name
EPCAM
Synonyms
Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; EGP; Epithelial cell surface antigen; Epithelial glycoprotein; Gastrointestinal carcinoma antigen GA733; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; EPCAM
Target Type
Clinical Trial
Disease Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
BioChemical Class
Transmembrane protein
UniProt ID
Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA
Drugs and Mode of Action
Drug(s) VB4-845 Drug Info Phase 2/3 Head and neck cancer [547580]
Citatuzumab bogatox Drug Info Phase 1 Cancer [522038]
ING-1 Drug Info Phase 1 Cancer [521543]
MT-110 Drug Info Phase 1 Solid tumours [531707]
IGN-101 Drug Info Discontinued in Phase 2 Colorectal cancer [547191]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
References
Ref 521543ClinicalTrials.gov (NCT00051675) Phase I Study of a Monoclonal Antibody for Treatment of Advanced Adenocarcinomas. U.S. National Institutes of Health.
Ref 522038ClinicalTrials.gov (NCT00481936) Study of the Safety of VB6-845 in Patients With Advanced Solid Tumours of Epithelial Origin. U.S. National Institutes of Health.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 547191Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013809)
Ref 547580Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017525)
Ref 527313ING-1, a monoclonal antibody targeting Ep-CAM in patients with advanced adenocarcinomas. Clin Cancer Res. 2004 Nov 15;10(22):7555-65.
Ref 528423Drug evaluation: IGN-101--an anti-EpCAM murine antibody vaccine for cancer. Curr Opin Mol Ther. 2006 Aug;8(4):358-65.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 531988Preclinical evaluation of VB6-845: an anti-EpCAM immunotoxin with reduced immunogenic potential. Cancer Biother Radiopharm. 2012 Nov;27(9):582-92.
Ref 544395A bispecific EpCAM/CD133 targeted toxin is effective against carcinoma. Target Oncol. 2014 September; 9(3): 239-249.