Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T48873
|
||||
| Former ID |
TTDS00118
|
||||
| Target Name |
Synaptic vesicle amine transporter
|
||||
| Gene Name |
SLC18A2
|
||||
| Synonyms |
Monoamine transporter; Solute carrier family 18 member 2; VAT; VMAT; Vesicular Monoamine Transporter ; Vesicular amine transporter; SLC18A2
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Chorea associated with huntington's disease [ICD10: G10] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Huntington's disease; Hyperkinetic movement disorder [ICD9:294.1, 333.4, 333; ICD10: F02.2, G10, G20-G26] | |||||
| High blood pressure [ICD9: 401; ICD10: I10-I16] | |||||
| Movement disorder [ICD10: R25] | |||||
| Substance dependence [ICD10: F10-F19] | |||||
| Tardive dyskinesia [ICD10: G24] | |||||
| Function |
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
|
||||
| BioChemical Class |
Major facilitator superfamily
|
||||
| Target Validation |
T48873
|
||||
| UniProt ID | |||||
| Sequence |
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alkavervir | Drug Info | Approved | High blood pressure | [551871] |
| Alseroxylon | Drug Info | Approved | Hypertension | [550752] | |
| Deutetrabenazine | Drug Info | Approved | Chorea associated with huntington's disease | [889446] | |
| Reserpine | Drug Info | Approved | Hypertension | [468055], [538424] | |
| Tetrabenazine | Drug Info | Approved | Huntington's disease; Hyperkinetic movement disorder | [468067], [529941], [530894], [532471], [538577], [551871] | |
| Valbenazine Tosylate | Drug Info | Approved | Tardive dyskinesia | [889446] | |
| AV 133 | Drug Info | Phase 3 | Alzheimer disease | [548627] | |
| NBI-98854 | Drug Info | Phase 3 | Movement disorder | [524967], [543251] | |
| Lobeline | Drug Info | Phase 2 | Substance dependence | [532434] | |
| Antagonist | 3,4-Methylenedioxymethamphetamine | Drug Info | [551382] | ||
| 4-Methoxyamphetamine | Drug Info | [551380] | |||
| MMDA | Drug Info | [551393] | |||
| Modulator | Alkavervir | Drug Info | [556264] | ||
| Deutetrabenazine | Drug Info | [556264] | |||
| Valbenazine Tosylate | Drug Info | [556264] | |||
| Blocker | Alseroxylon | Drug Info | [536284] | ||
| Reserpine | Drug Info | [537569] | |||
| Tetrabenazine | Drug Info | [537083], [537569] | |||
| Enhancer | AV 133 | Drug Info | [532499] | ||
| Inhibitor | Lobeline | Drug Info | [531251] | ||
| NBI-98854 | Drug Info | [533314] | |||
| [11C]DTBZ | Drug Info | [543358] | |||
| [125I]7-azido-8-iodoketanserine | Drug Info | [534484] | |||
| [3H]TBZOH | Drug Info | [534267] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Synaptic vesicle cycle | ||||
| Serotonergic synapse | |||||
| Dopaminergic synapse | |||||
| Parkinson' | |||||
| s disease | |||||
| Cocaine addiction | |||||
| Amphetamine addiction | |||||
| Alcoholism | |||||
| PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
| 5HT1 type receptor mediated signaling pathway | |||||
| 5HT2 type receptor mediated signaling pathway | |||||
| 5HT3 type receptor mediated signaling pathway | |||||
| 5HT4 type receptor mediated signaling pathway | |||||
| Dopamine receptor mediated signaling pathway | |||||
| Nicotine pharmacodynamics pathway | |||||
| CCKR signaling map ST | |||||
| Reactome | Norepinephrine Neurotransmitter Release Cycle | ||||
| Na+/Cl- dependent neurotransmitter transporters | |||||
| WikiPathways | Dopaminergic Neurogenesis | ||||
| Synaptic Vesicle Pathway | |||||
| Neurotransmitter Release Cycle | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 468055 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4823). | ||||
| Ref 468067 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4834). | ||||
| Ref 524967 | ClinicalTrials.gov (NCT02274558) A Phase 3 Study of NBI-98854 for the Treatment of Tardive Dyskinesia. U.S. National Institutes of Health. | ||||
| Ref 530894 | Role of tetrabenazine for Huntington's disease-associated chorea. Ann Pharmacother. 2010 Jun;44(6):1080-9. | ||||
| Ref 532434 | Effects of VMAT2 inhibitors lobeline and GZ-793A on methamphetamine-induced changes in dopamine release, metabolism and synthesis in vivo. J Neurochem. 2013 Oct;127(2):187-98. | ||||
| Ref 532471 | The druggable genome: Evaluation of drug targets in clinical trials suggests major shifts in molecular class and indication. Annu Rev Pharmacol Toxicol. 2014;54:9-26. | ||||
| Ref 538424 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009838. | ||||
| Ref 538577 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021894. | ||||
| Ref 543251 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8694). | ||||
| Ref 548627 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027191) | ||||
| Ref 531251 | Design, synthesis and interaction at the vesicular monoamine transporter-2 of lobeline analogs: potential pharmacotherapies for the treatment of psychostimulant abuse. Curr Top Med Chem. 2011;11(9):1103-27. | ||||
| Ref 532499 | Brain imaging of vesicular monoamine transporter type 2 in healthy aging subjects by 18F-FP-(+)-DTBZ PET. PLoS One. 2013 Sep 30;8(9):e75952. | ||||
| Ref 533314 | NBI-98854, a selective monoamine transport inhibitor for the treatment of tardive dyskinesia: A randomized, double-blind, placebo-controlled study. Mov Disord. 2015 Oct;30(12):1681-7. | ||||
| Ref 534267 | Active transport of acetylcholine by the human vesicular acetylcholine transporter. J Biol Chem. 1996 Nov 1;271(44):27229-32. | ||||
| Ref 534484 | Peptide mapping of the [125I]Iodoazidoketanserin and [125I]2-N-[(3'-iodo-4'-azidophenyl)propionyl]tetrabenazine binding sites for the synaptic vesicle monoamine transporter. J Biol Chem. 1997 Oct 10;272(41):26049-55. | ||||
| Ref 536284 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
| Ref 537083 | 11C-dihydrotetrabenazine PET of the pancreas in subjects with long-standing type 1 diabetes and in healthy controls. J Nucl Med. 2009 Mar;50(3):382-9. Epub 2009 Feb 17. | ||||
| Ref 537569 | Dopamine signaling is required for depolarization-induced slow current in cerebellar Purkinje cells. J Neurosci. 2009 Jul 1;29(26):8530-8. | ||||
| Ref 543358 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1012). | ||||
| Ref 551380 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
