Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T49989
|
||||
| Former ID |
TTDI02190
|
||||
| Target Name |
TGF-beta type II receptor
|
||||
| Gene Name |
TGFBR2
|
||||
| Synonyms |
TGF-beta receptor type II; TGF-beta receptor type-2; TGFR-2; TbetaR-II; Transforminggrowth factor-beta receptor type II; TGFBR2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Wound healing [ICD10: T14.0-T14.1] | |||||
| Function |
Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non- canonical, SMAD-independent TGF-beta signaling pathways.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.30
|
||||
| Sequence |
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE LEHLDRLSGRSCSEEKIPEDGSLNTTK |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| FoxO signaling pathway | |||||
| Endocytosis | |||||
| TGF-beta signaling pathway | |||||
| Osteoclast differentiation | |||||
| Hippo signaling pathway | |||||
| Adherens junction | |||||
| Chagas disease (American trypanosomiasis) | |||||
| HTLV-I infection | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Colorectal cancer | |||||
| Pancreatic cancer | |||||
| Chronic myeloid leukemia | |||||
| NetPath Pathway | FSH Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| PANTHER Pathway | TGF-beta signaling pathway | ||||
| Pathway Interaction Database | Glypican 1 network | ||||
| Beta3 integrin cell surface interactions | |||||
| Integrins in angiogenesis | |||||
| ALK1 signaling events | |||||
| TGF-beta receptor signaling | |||||
| Reactome | TGF-beta receptor signaling activates SMADs | ||||
| TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) | |||||
| SMAD2/3 Phosphorylation Motif Mutants in Cancer | |||||
| SMAD2/3 MH2 Domain Mutants in Cancer | |||||
| TGFBR2 Kinase Domain Mutants in Cancer | |||||
| TGFBR1 KD Mutants in Cancer | |||||
| TGFBR1 LBD Mutants in Cancer | |||||
| WikiPathways | TGF Beta Signaling Pathway | ||||
| MAPK Signaling Pathway | |||||
| TGF beta Signaling Pathway | |||||
| NRF2 pathway | |||||
| Nuclear Receptors Meta-Pathway | |||||
| Extracellular vesicle-mediated signaling in recipient cells | |||||
| Signaling by TGF-beta Receptor Complex | |||||
| miR-targeted genes in squamous cell - TarBase | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| miR-targeted genes in adipocytes - TarBase | |||||
| Integrated Breast Cancer Pathway | |||||
| References | |||||
| Ref 528084 | J Med Chem. 2006 Mar 23;49(6):2138-42.Dihydropyrrolopyrazole transforming growth factor-beta type I receptor kinase domain inhibitors: a novel benzimidazole series with selectivity versus transforming growth factor-beta type II receptor kinase and mixed lineage kinase-7. | ||||
| Ref 529427 | LY2109761, a novel transforming growth factor beta receptor type I and type II dual inhibitor, as a therapeutic approach to suppressing pancreatic cancer metastasis. Mol Cancer Ther. 2008 Apr;7(4):829-40. | ||||
| Ref 532338 | Synthesis and structure-activity relationships of a novel and selective bone morphogenetic protein receptor (BMP) inhibitor derived from the pyrazolo[1.5-a]pyrimidine scaffold of dorsomorphin: the discovery of ML347 as an ALK2 versus ALK3 selective MLPCN probe. Bioorg Med Chem Lett. 2013 Jun 1;23(11):3248-52. | ||||
