Target Information

Target General Infomation
Target ID
T51693
Former ID
TTDR00750
Target Name
Melanoma-associated antigen 3
Gene Name
MAGEA3
Synonyms
Antigen MZ2-D; MAGE-3 antigen; MAGE-A3; MAGE-A3 antigen; Melanoma antigen 3; Melanoma associated antigen-A3; MAGEA3
Target Type
Clinical Trial
Disease Adjuvant non-small-cell lung carcinoma; Melanoma [ICD9:162, 172; ICD10: C33, C34, C43]
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21]
Melanoma [ICD9: 172; ICD10: C43]
Function
Proposed to enhance ubiquitin ligase activity of RING- type zinc finger-containing E3 ubiquitin-protein ligases. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
BioChemical Class
Melanoma associated antigen family
UniProt ID
P43357
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFAT
CLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILG
DPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHIS
YPPLHEWVLREGEE
Drugs and Mode of Action
Drug(s) Astuprotimut-R Drug Info Phase 3 Adjuvant non-small-cell lung carcinoma; Melanoma [522494]
IDM-2101 Drug Info Phase 2 Colorectal cancer [529705]
Polynoma-1 Drug Info Phase 2 Melanoma [551529]
Melanoma vaccine Drug Info Discontinued in Phase 2 Melanoma [547218]
Modulator Astuprotimut-R Drug Info [550432]
References
Ref 522494ClinicalTrials.gov (NCT00796445) A Phase III Study to Test the Benefit of a New Kind of Anti-cancer Treatment in Patients With Melanoma, After Surgical Removal of Their Tumor. U.S. National Institutes of Health.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 547218Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153)
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.
Ref 529705Induction of immune responses and clinical efficacy in a phase II trial of IDM-2101, a 10-epitope cytotoxic T-lymphocyte vaccine, in metastatic non-small-cell lung cancer. J Clin Oncol. 2008 Sep 20;26(27):4418-25.
Ref 531162Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.
Ref 550432National Cancer Institute Drug Dictionary (drug id 600553).
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.