Target General Infomation
Target ID
T58449
Former ID
TTDC00094
Target Name
Cell division protein kinase 7
Gene Name
CDK7
Synonyms
39 kDa protein kinase; CAK; CAK1; CDK-activating kinase; Cyclin-dependent kinase 7; P39 Mo15; STK1; TFIIH basal transcription factor complex kinase subunit; CDK7
Target Type
Clinical Trial
Disease Advanced solid tumor [ICD9: 140-199; ICD10: C00-C75, C7A, C7B]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin- dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.
BioChemical Class
Kinase
Target Validation
T58449
UniProt ID
EC Number
EC 2.7.11.23
Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Drugs and Mode of Action
Drug(s) R-roscovitine Drug Info Phase 2 Cancer [524796]
SNS-032 Drug Info Phase 1 Solid tumours [537097], [541014]
R547 Drug Info Discontinued in Phase 1 Advanced solid tumor [541047], [547737]
ZK 304709 Drug Info Discontinued in Phase 1 Advanced solid tumor [548143]
Inhibitor 2,5-dichloro-N-p-tolylthiophene-3-sulfonamide Drug Info [551239]
NU6140 Drug Info [527749]
PF-228 Drug Info [528764]
Phosphonothreonine Drug Info [551393]
R-roscovitine Drug Info [537564]
R547 Drug Info [537564]
RGB-286147 Drug Info [529213]
SNS-032 Drug Info [537097], [537228]
THZ1 Drug Info [532889]
ZK 304709 Drug Info [537564]
Pathways
KEGG Pathway Basal transcription factors
Nucleotide excision repair
Cell cycle
NetPath Pathway TCR Signaling Pathway
RANKL Signaling Pathway
Pathway Interaction Database Retinoic acid receptors-mediated signaling
Reactome NoRC negatively regulates rRNA expression
Formation of TC-NER Pre-Incision Complex
Dual incision in TC-NER
Gap-filling DNA repair synthesis and ligation in TC-NER
Cyclin E associated events during G1/S transition
Cyclin D associated events in G1
Cyclin A/B1 associated events during G2/M transition
Cdk2-associated events at S phase entry
RNA Polymerase I Transcription Initiation
WikiPathways G1 to S cell cycle control
Eukaryotic Transcription Initiation
Cardiac Hypertrophic Response
S Phase
HIV Life Cycle
Integrated Breast Cancer Pathway
Nucleotide Excision Repair
RNA Polymerase II Transcription
RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
mRNA Capping
Mitotic G2-G2/M phases
Mitotic G1-G1/S phases
MicroRNAs in cardiomyocyte hypertrophy
References
Ref 524796ClinicalTrials.gov (NCT02160730) Treatment of Cushing's Disease With R-roscovitine. U.S. National Institutes of Health.
Ref 537097Mechanism of action of SNS-032, a novel cyclin-dependent kinase inhibitor, in chronic lymphocytic leukemia. Blood. 2009 May 7;113(19):4637-45. Epub 2009 Feb 20.
Ref 541014(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5670).
Ref 541047(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5707).
Ref 547737Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018924)
Ref 548143Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022386)
Ref 527749Potentiation of paclitaxel-induced apoptosis by the novel cyclin-dependent kinase inhibitor NU6140: a possible role for survivin down-regulation. Mol Cancer Ther. 2005 Sep;4(9):1328-37.
Ref 528764J Biol Chem. 2007 May 18;282(20):14845-52. Epub 2007 Mar 28.Cellular characterization of a novel focal adhesion kinase inhibitor.
Ref 529213Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases.
Ref 532889Targeting transcription regulation in cancer with a covalent CDK7 inhibitor. Nature. 2014 Jul 31;511(7511):616-20.
Ref 537097Mechanism of action of SNS-032, a novel cyclin-dependent kinase inhibitor, in chronic lymphocytic leukemia. Blood. 2009 May 7;113(19):4637-45. Epub 2009 Feb 20.
Ref 537228Development of cell-cycle inhibitors for cancer therapy. Curr Oncol. 2009 Mar;16(2):36-43.
Ref 537564Cell cycle kinases as therapeutic targets for cancer. Nat Rev Drug Discov. 2009 Jul;8(7):547-66.
Ref 551239Activity of substituted thiophene sulfonamides against malarial and mammalian cyclin dependent protein kinases, Bioorg. Med. Chem. Lett. 20(13):3863-3867 (2010).
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.