Target General Infomation
Target ID
T75256
Former ID
TTDI02120
Target Name
MART-1 melanoma antigen
Gene Name
MLANA
Synonyms
Antigen LB39AA; Antigen SK29AA; MART1; Melanoma antigen recognized by Tcells 1; Protein MelanA; MLANA
Target Type
Clinical Trial
Disease Melanoma [ICD9: 172; ICD10: C43]
Function
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
BioChemical Class
Melanoma antigen recognized by T cells 1
UniProt ID
Sequence
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Drugs and Mode of Action
Drug(s) Melanoma vaccine Drug Info Phase 3 Melanoma [521514]
Multi-epitope peptide melanoma vaccine Drug Info Phase 3 Melanoma [521514]
MKC-1106-MT Drug Info Phase 2 Melanoma [522880]
Polynoma-1 Drug Info Phase 2 Melanoma [551529]
Melanoma vaccine Drug Info Discontinued in Phase 2 Melanoma [547218]
F-50040 Drug Info Discontinued in Phase 1 Melanoma [547414]
Modulator F-50040 Drug Info [526271]
MKC-1106-MT Drug Info [1572591]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
References
Ref 521514ClinicalTrials.gov (NCT00036816) Vaccine Therapy in Treating Patients With Melanoma of the Eye. U.S. National Institutes of Health.
Ref 522880ClinicalTrials.gov (NCT01026051) Safety, Immune and Tumor Response to a Multi-component Immune Based Therapy (MKC1106-MT) for Patients With Melanoma. U.S. National Institutes of Health.
Ref 547218Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153)
Ref 547414Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016041)
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.
Ref
Ref 526271Stability and CTL-activity of P40/ELA melanoma vaccine candidate. Biologicals. 2001 Sep-Dec;29(3-4):293-8.
Ref 531162Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.
Ref 544270Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in-adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. Correction in: volume 35 on page 650.
Ref 550463National Cancer Institute Drug Dictionary (drug id 685201).
Ref 551529An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.