Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T75440
|
||||
| Former ID |
TTDS00454
|
||||
| Target Name |
Peripheral-type benzodiazepine receptor
|
||||
| Gene Name |
TSPO
|
||||
| Synonyms |
Mitochondrial benzodiazepine receptor; PBR; PKBS; Peripheral benzodiazepine receptor; Translocator protein; TSPO
|
||||
| Target Type |
Successful
|
||||
| Disease | Anxiety disorder; Insomnia [ICD9: 300, 307.4, 327.0; ICD10: F40-F42, F51.0, G47.0] | ||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Anxiety disorder; Status epilepticus [ICD9: 300, 345.3; ICD10: F40-F42, G40] | |||||
| Brain diseases [ICD10: G00-G99] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Convulsions [ICD9: 780.3; ICD10: R56.0] | |||||
| Epilepsy [ICD10: G40] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Irritable bowel syndrome [ICD9: 564.1, 787.91; ICD10: A09, K58, K59.1] | |||||
| Lateral sclerosis [ICD10: G12.2] | |||||
| Muscle relaxant [ICD10: N39.3, N39.4, R32] | |||||
| Nootropic [ICD10: F00-F99] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Sedation [ICD9: 338; ICD10: R52, G89] | |||||
| Spasms; Pain; Anxiety disorder [ICD9:338, 780, 300, 311; ICD10: R52, G89, F32, F40-F42] | |||||
| Function |
Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides(PubMed:1847678).
|
||||
| BioChemical Class |
Cholesterol porphyrin uptake translocator
|
||||
| Target Validation |
T75440
|
||||
| UniProt ID | |||||
| Sequence |
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Adinazolam | Drug Info | Approved | Anxiety disorder; Status epilepticus | [550684] |
| ALPIDEM | Drug Info | Approved | Anxiety disorder | [551871] | |
| Alprazolam | Drug Info | Approved | Anxiety disorder | [538259], [542118] | |
| Chlordiazepoxide | Drug Info | Approved | Anxiety disorder | [535828], [540324] | |
| Chlormezanone | Drug Info | Approved | Spasms; Pain; Anxiety disorder | [538447], [542346], [551871] | |
| Cinolazepam | Drug Info | Approved | Muscle relaxant | [550708] | |
| Clorazepate | Drug Info | Approved | Anxiety disorder; Insomnia | [538240], [542549] | |
| Clotiazepam | Drug Info | Approved | Anxiety disorder | [550777] | |
| Diazepam | Drug Info | Approved | Epilepsy | [524426], [540319] | |
| Estazolam | Drug Info | Approved | Insomnia | [538287], [542551] | |
| Eszopiclone | Drug Info | Approved | Insomnia | [536647], [542452] | |
| Fludiazepam | Drug Info | Approved | Anxiety disorder | [550695] | |
| Flumazenil | Drug Info | Approved | Benzodiazepine overdoses | [467528], [522823] | |
| Flunitrazepam | Drug Info | Approved | Insomnia | [467696], [550754] | |
| Flurazepam | Drug Info | Approved | Insomnia | [538223], [542199] | |
| Halazepam | Drug Info | Approved | Anxiety disorder | [538493], [542207] | |
| Lorazepam | Drug Info | Approved | Anxiety disorder | [538231], [541183] | |
| Midazolam | Drug Info | Approved | Sedation | [538292], [540301] | |
| Oxazepam | Drug Info | Approved | Anxiety disorder | [536565], [542271] | |
| Prazepam | Drug Info | Approved | Anxiety disorder | [542295], [550778] | |
| Quazepam | Drug Info | Approved | Insomnia | [538513], [542308] | |
| Temazepam | Drug Info | Approved | Insomnia | [538229], [542322] | |
| Triazolam | Drug Info | Approved | Insomnia | [536565], [542336] | |
| 11C-PBR-28 | Drug Info | Phase 2 | Brain diseases | [525281] | |
| Dextofisopam | Drug Info | Phase 2 | Irritable bowel syndrome | [536224] | |
| ONO-2952 | Drug Info | Phase 2 | Irritable bowel syndrome | [524339] | |
| SSR-180575 | Drug Info | Phase 2 | Rheumatoid arthritis | [522067] | |
| TLN-4601 | Drug Info | Phase 2 | Cancer | [522396] | |
| 18F-FEDAA-1106 | Drug Info | Phase 1 | Alzheimer disease | [549054] | |
| BAY-85-8102 | Drug Info | Phase 1 | Brain diseases | [522842] | |
| Ro-16-6028 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [467491], [544696] | |
| Emapunil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [543259], [547175] | |
| Lirequinil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [545048] | |
| S-8510 | Drug Info | Discontinued in Phase 2 | Nootropic | [545890] | |
| TRO-40303 | Drug Info | Discontinued in Phase 2 | Lateral sclerosis | [549216] | |
| Imepitoin | Drug Info | Discontinued in Phase 1 | Convulsions | [546470] | |
| DAA-1097 | Drug Info | Terminated | Anxiety disorder | [547051] | |
| Ginkgolide B (GKB) | Drug Info | Terminated | Discovery agent | [544554] | |
| Miltirone | Drug Info | Terminated | Anxiety disorder | [545493] | |
| NNC-13-8119 | Drug Info | Terminated | Anxiety disorder | [545660] | |
| NS-2979 | Drug Info | Terminated | Pain | [547155] | |
| PK 11195 | Drug Info | Terminated | Discovery agent | [543258], [544695] | |
| Ro 5-4864 | Drug Info | Terminated | Discovery agent | [545047] | |
| Inhibitor | (R)PK-11195 | Drug Info | [526488] | ||
| 2-(2-Phenyl-1H-indol-3-yl)-N,N-dipropyl-acetamide | Drug Info | [534032] | |||
| 4-Methoxy-5-phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [533589] | |||
| 5-Phenyl-6-thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [533922] | |||
| 5-Phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [533589] | |||
| 6-Thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [533922] | |||
| ALPIDEM | Drug Info | [529656] | |||
| N,N-Diethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [534032] | |||
| N,N-Dihexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [534032] | |||
| N,N-Dimethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [534032] | |||
| N-Hexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [534032] | |||
| SSR-180575 | Drug Info | [526341], [551871] | |||
| Binder | 11C-PBR-170 | Drug Info | [543743] | ||
| 11C-PBR-28 | Drug Info | [528547] | |||
| Cinolazepam | Drug Info | [537708] | |||
| FGIN-1-27 | Drug Info | [535317] | |||
| PK 11195 | Drug Info | [535317] | |||
| Ro 5-4864 | Drug Info | [535317], [538133] | |||
| TGSC01AA(4) | Drug Info | [543743] | |||
| Modulator | 18F-FEDAA-1106 | Drug Info | [526694] | ||
| Chlordiazepoxide | Drug Info | [556264] | |||
| Clorazepate | Drug Info | [556264] | |||
| Flurazepam | Drug Info | [556264] | |||
| Halazepam | Drug Info | [556264] | |||
| Lorazepam | Drug Info | [556264] | |||
| Midazolam | Drug Info | [556264] | |||
| Miltirone | Drug Info | [528077] | |||
| NNC-13-8119 | Drug Info | [545661] | |||
| NS-2979 | Drug Info | [547156] | |||
| Prazepam | Drug Info | [556264] | |||
| Quazepam | Drug Info | [556264] | |||
| Ro-16-6028 | Drug Info | ||||
| Temazepam | Drug Info | [556264] | |||
| TLN-4601 | Drug Info | ||||
| Triazolam | Drug Info | [556264] | |||
| TRO-40303 | Drug Info | [544374] | |||
| U-89854 | Drug Info | [543743] | |||
| Agonist | Adinazolam | Drug Info | [534872] | ||
| Alprazolam | Drug Info | [536166], [537330] | |||
| BAY-85-8102 | Drug Info | [543743] | |||
| Benzodiazepine | Drug Info | [543743] | |||
| Chlormezanone | Drug Info | [537816] | |||
| Clotiazepam | Drug Info | [537693] | |||
| DAA-1097 | Drug Info | [525488] | |||
| Dextofisopam | Drug Info | [536224] | |||
| Diazemuls | Drug Info | [537354] | |||
| Diazepam | Drug Info | [530408] | |||
| Emapunil | Drug Info | [536580] | |||
| Estazolam | Drug Info | [535677], [536079] | |||
| Eszopiclone | Drug Info | [536166], [536625] | |||
| Fludiazepam | Drug Info | [537701] | |||
| Flunitrazepam | Drug Info | [537330] | |||
| Imepitoin | Drug Info | [532596] | |||
| Lirequinil | Drug Info | [534064] | |||
| Oxazepam | Drug Info | [536807] | |||
| S-8510 | Drug Info | [551871] | |||
| Antagonist | Flumazenil | Drug Info | [543743] | ||
| ONO-2952 | Drug Info | [533291] | |||
| Suppressor | Ginkgolide B (GKB) | Drug Info | [535072] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| HTLV-I infection | |||||
| References | |||||
| Ref 467491 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4146). | ||||
| Ref 467528 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4192). | ||||
| Ref 467696 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4360). | ||||
| Ref 522067 | ClinicalTrials.gov (NCT00502515) Dose-effect of SSR180575 in Diabetic Neuropathy. U.S. National Institutes of Health. | ||||
| Ref 522396 | ClinicalTrials.gov (NCT00730262) Efficacy Study of TLN-4601 in Patients With Recurring Glioblastoma Multiforme. U.S. National Institutes of Health. | ||||
| Ref 522823 | ClinicalTrials.gov (NCT00997087) A Randomized, Double-Blind, Placebo-Controlled Trial of Flumazenil for the Treatment of Obsessive Compulsive Disorder. U.S. National Institutes of Health. | ||||
| Ref 522842 | ClinicalTrials.gov (NCT01009359) Evaluation of the Neuroinflammation Pattern of BAY85-8102 F-18, DPA-714 in Probable Alzheimers Disease Patients Versus Healthy Volunteers and Radiation Dosimetry of F18, DPA-714 in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 524339 | ClinicalTrials.gov (NCT01887002) Study to Evaluate the Effects of ONO-2952 on Pain Perception Produced by Rectal Distention in Female Subjects With Diarrhea-Predominant Irritable Bowel Syndrome (IBS-D). U.S. National Institutes of Health. | ||||
| Ref 524426 | ClinicalTrials.gov (NCT01939093) Therapeutic Effect of Quetiapine on Methamphetamine-Induced Psychosis. U.S. National Institutes of Health. | ||||
| Ref 525281 | ClinicalTrials.gov (NCT02513589) Molecular Imaging of Inflammation With 18F-PBR06 to Identify Unstable Carotid Plaques in Patients With Stroke. | ||||
| Ref 535828 | Use of the accelerating rotarod for assessment of motor performance decrement induced by potential anticonvulsant compounds in nerve agent poisoning. Drug Chem Toxicol. 1992;15(3):177-201. | ||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536565 | What every dentist should know about the "z-sedatives". J Mass Dent Soc. 2007 Fall;56(3):44-5. | ||||
| Ref 538223 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070344. | ||||
| Ref 538229 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070919. | ||||
| Ref 538231 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071117. | ||||
| Ref 538240 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071852. | ||||
| Ref 538259 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074046. | ||||
| Ref 538287 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074818. | ||||
| Ref 538292 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075154. | ||||
| Ref 538447 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011467. | ||||
| Ref 538493 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017736. | ||||
| Ref 538513 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018708. | ||||
| Ref 540301 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3342). | ||||
| Ref 540319 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3364). | ||||
| Ref 540324 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3370). | ||||
| Ref 541183 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5884). | ||||
| Ref 542118 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7111). | ||||
| Ref 542199 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7188). | ||||
| Ref 542207 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7195). | ||||
| Ref 542271 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7253). | ||||
| Ref 542295 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7275). | ||||
| Ref 542308 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7288). | ||||
| Ref 542322 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7300). | ||||
| Ref 542336 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7313). | ||||
| Ref 542346 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7323). | ||||
| Ref 542452 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7429). | ||||
| Ref 542549 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7548). | ||||
| Ref 542551 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7550). | ||||
| Ref 543258 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8703). | ||||
| Ref 543259 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8704). | ||||
| Ref 544554 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000117) | ||||
| Ref 544695 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000635) | ||||
| Ref 544696 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000640) | ||||
| Ref 545047 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001966) | ||||
| Ref 545048 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001968) | ||||
| Ref 545493 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003466) | ||||
| Ref 545660 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060) | ||||
| Ref 545890 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005238) | ||||
| Ref 546470 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008368) | ||||
| Ref 547051 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012540) | ||||
| Ref 547155 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | ||||
| Ref 547175 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013611) | ||||
| Ref 549054 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031827) | ||||
| Ref 525488 | Neuropharmacological profile of peripheral benzodiazepine receptor agonists, DAA1097 and DAA1106. Life Sci. 1999;64(16):1455-64. | ||||
| Ref 526341 | SSR180575 (7-chloro-N,N,5-trimethyl-4-oxo-3-phenyl-3,5-dihydro-4H-pyridazino[4,5-b]indole-1-acetamide), a peripheral benzodiazepine receptor ligand, promotes neuronal survival and repair. J PharmacolExp Ther. 2002 Jun;301(3):1067-78. | ||||
| Ref 526488 | Bioorg Med Chem Lett. 2003 Jan 20;13(2):201-4.[18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). | ||||
| Ref 526694 | Role of peripheral benzodiazepine receptors in mitochondrial, cellular, and cardiac damage induced by oxidative stress and ischemia-reperfusion. J Pharmacol Exp Ther. 2003 Sep;306(3):828-37. | ||||
| Ref 528077 | Miltirone, a central benzodiazepine receptor partial agonist from a Chinese medicinal herb Salvia miltiorrhiza. Neurosci Lett. 1991 Jun 24;127(2):237-41. | ||||
| Ref 528547 | PET imaging with [11C]PBR28 can localize and quantify upregulated peripheral benzodiazepine receptors associated with cerebral ischemia in rat. Neurosci Lett. 2007 Jan 16;411(3):200-5. Epub 2006 Nov28. | ||||
| Ref 529656 | J Med Chem. 2008 Sep 25;51(18):5798-806. Epub 2008 Aug 26.Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. | ||||
| Ref 530408 | Translocator protein (18 kDa) mediates the pro-growth effects of diazepam on Ehrlich tumor cells in vivo. Eur J Pharmacol. 2010 Jan 25;626(2-3):131-8. | ||||
| Ref 532596 | The pharmacology of imepitoin: the first partial benzodiazepine receptor agonist developed for the treatment of epilepsy. CNS Drugs. 2014 Jan;28(1):29-43. | ||||
| Ref 533291 | Anti-stress effects of ONO-2952, a novel translocator protein 18 kDa antagonist, in rats. Neuropharmacology. 2015 Jul 17;99:51-66. | ||||
| Ref 533589 | J Med Chem. 1995 Nov 10;38(23):4730-8.A concerted study using binding measurements, X-ray structural data, and molecular modeling on the stereochemical features responsible for the affinity of 6-arylpyrrolo[2,1-d][1,5]benzothiazepines toward mitochondrial benzodiazepine receptors. | ||||
| Ref 533922 | J Med Chem. 1994 May 13;37(10):1427-38.Novel ligands specific for mitochondrial benzodiazepine receptors: 6-arylpyrrolo[2,1-d][1,5]benzothiazepine derivatives. Synthesis, structure-activity relationships, and molecular modeling studies. | ||||
| Ref 534032 | J Med Chem. 1993 Oct 1;36(20):2908-20.Chemistry, binding affinities, and behavioral properties of a new class of "antineophobic" mitochondrial DBI receptor complex (mDRC) ligands. | ||||
| Ref 534064 | Pharmacokinetics and pharmacodynamics of Ro 41-3696, a novel nonbenzodiazepine hypnotic. J Clin Pharmacol. 1995 Aug;35(8):821-9. | ||||
| Ref 534872 | Effects of antidepressants and benzodiazepine treatments on the dendritic structure of CA3 pyramidal neurons after chronic stress. Eur J Pharmacol. 1999 Apr 29;371(2-3):113-22. | ||||
| Ref 535072 | Drug-induced inhibition of the peripheral-type benzodiazepine receptor expression and cell proliferation in human breast cancer cells. Anticancer Res. 2000 Sep-Oct;20(5A):2835-47. | ||||
| Ref 535317 | Specific ligands of the peripheral benzodiazepine receptor induce apoptosis and cell cycle arrest in human colorectal cancer cells. Br J Cancer. 2001 Nov 30;85(11):1771-80. | ||||
| Ref 535677 | Design and synthesis of 4H-3-(2-phenoxy)phenyl-1,2,4-triazole derivatives as benzodiazepine receptor agonists. Bioorg Med Chem. 2003 Mar 6;11(5):769-73. | ||||
| Ref 536079 | Design and synthesis of new 2-substituted-5-(2-benzylthiophenyl)-1,3,4-oxadiazoles as benzodiazepine receptor agonists. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3126-9. | ||||
| Ref 536224 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 536807 | Effects of the combination of metyrapone and oxazepam on cocaine and food self-administration in rats. Pharmacol Biochem Behav. 2008 Nov;91(1):181-9. Epub 2008 Jul 19. | ||||
| Ref 537330 | Comparison of five benzodiazepine-receptor agonists on buprenorphine-induced mu-opioid receptor regulation. J Pharmacol Sci. 2009 May;110(1):36-46. | ||||
| Ref 537354 | The alpha5(H105R) mutation impairs alpha5 selective binding properties by altered positioning of the alpha5 subunit in GABAA receptors containing two distinct types of alpha subunits. J Neurochem. 2009 Jul;110(1):244-54. Epub 2009 Apr 27. | ||||
| Ref 537693 | Effects of benzodiazepines and non-benzodiazepine compounds on the GABA-induced response in frog isolated sensory neurones. Br J Pharmacol. 1989 Nov;98(3):735-40. | ||||
| Ref 537701 | Benzodiazepines and their metabolites: relationship between binding affinity to the benzodiazepine receptor and pharmacological activity. Life Sci. 1985 Jan 14;36(2):113-9. | ||||
| Ref 537708 | Short-term sleep laboratory studies with cinolazepam in situational insomnia induced by traffic noise. Int J Clin Pharmacol Res. 1987;7(5):407-18. | ||||
| Ref 537816 | Successful treatment of anxiety with a single night-time dose of chlormezanone: double-blind comparison with diazepam. Curr Med Res Opin. 1982;8(1):33-8. | ||||
| Ref 538133 | Antiproliferative and differentiating effects of benzodiazepine receptor ligands on B16 melanoma cells. Biochem Pharmacol. 1998 Oct 15;56(8):1029-34. | ||||
| Ref 543743 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2879). | ||||
| Ref 544374 | Translation of TRO40303 from myocardial infarction models to demonstration of safety and tolerance in a randomized Phase I trial. J Transl Med. 2014; 12: 38. | ||||
| Ref 545661 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060) | ||||
| Ref 547156 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | ||||
