Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T82393
|
||||
| Former ID |
TTDR00847
|
||||
| Target Name |
ADAM 17
|
||||
| Gene Name |
ADAM17
|
||||
| Synonyms |
A disintegrin and metalloproteinase domain 17; CD156b antigen; Snake venom-like protease; TACE; TNF-alpha convertase; TNF-alpha converting enzyme; TNFalpha converting enzyme; ADAM17
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Inflammatory bowel disease; Rheumatoid arthritis [ICD9: 555, 556, 710-719, 714; ICD10: K50, K51, M00-M25, M05-M06] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface. Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein. Acts as an activator of Notch pathway by mediating cleavage of Notch, generating the membrane-associated intermediate fragment called Notch extracellular truncation (NEXT). Plays a role in the proteolytic processing of ACE2.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T82393
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.24.86
|
||||
| Sequence |
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Apratastat | Drug Info | Phase 2 | Rheumatoid arthritis | [521616], [541616] |
| Aderbasib | Drug Info | Phase 1/2 | Breast cancer | [524760] | |
| GW-3333 | Drug Info | Preclinical | Chronic obstructive pulmonary disease | [536223] | |
| DPC-333 | Drug Info | Terminated | Inflammatory bowel disease; Rheumatoid arthritis | [536223], [541646] | |
| Inhibitor | 2-(4-bromophenylsulfonamido)-N-hydroxyacetamide | Drug Info | [530746] | ||
| 2-(biphenyl-4-ylsulfonamido)-N-hydroxyacetamide | Drug Info | [530746] | |||
| Batimistat | Drug Info | [538112] | |||
| CH4474 | Drug Info | [535881] | |||
| DPC-333 | Drug Info | [536223] | |||
| GW-3333 | Drug Info | [536223] | |||
| IK-682 | Drug Info | [529692] | |||
| IK-862 | Drug Info | [529692] | |||
| IM-491 | Drug Info | [529165] | |||
| N-hydroxy-2-(4-methoxyphenylsulfonamido)acetamide | Drug Info | [530746] | |||
| N-hydroxy-3-(2-oxo-2H-chromen-3-yl)propanamide | Drug Info | [529102] | |||
| N-hydroxy-3-(6-methoxy-2-oxo-2H-chromen-3-yl) | Drug Info | [529102] | |||
| PKF-241-466 | Drug Info | [529876] | |||
| PKF-242-484 | Drug Info | [529876] | |||
| SL422 | Drug Info | [526113] | |||
| SR-973 | Drug Info | [528025] | |||
| TACE inhibitors | Drug Info | [543456] | |||
| TMI-05 | Drug Info | [527982] | |||
| Modulator | Aderbasib | Drug Info | [1572591] | ||
| Apratastat | Drug Info | [528532], [536688] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Notch signaling pathway | ||||
| Alzheimer' | |||||
| s disease | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| PANTHER Pathway | Alzheimer disease-amyloid secretase pathway | ||||
| Alzheimer disease-presenilin pathway | |||||
| Notch signaling pathway | |||||
| Pathway Interaction Database | ErbB4 signaling events | ||||
| TNF receptor signaling pathway | |||||
| p75(NTR)-mediated signaling | |||||
| Reactome | Nuclear signaling by ERBB4 | ||||
| Collagen degradation | |||||
| Regulated proteolysis of p75NTR | |||||
| Activated NOTCH1 Transmits Signal to the Nucleus | |||||
| Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 t(7 | |||||
| M1580_K2555) Translocation Mutant | |||||
| Constitutive Signaling by NOTCH1 HD Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
| TNF signaling | |||||
| Growth hormone receptor signaling | |||||
| WikiPathways | Notch Signaling Pathway | ||||
| Copper homeostasis | |||||
| Notch Signaling Pathway | |||||
| Growth hormone receptor signaling | |||||
| BDNF signaling pathway | |||||
| Alzheimers Disease | |||||
| Signalling by NGF | |||||
| Extrinsic Pathway for Apoptosis | |||||
| References | |||||
| Ref 521616 | ClinicalTrials.gov (NCT00095342) Study Evaluating TMI-005 in Active Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 524760 | ClinicalTrials.gov (NCT02141451) INCB7839 With Rituximab After Autologous Hematopoietic Cell Transplantation for Diffuse Large B Cell Non-Hodgkin Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
| Ref 526113 | Design, synthesis, and structure-activity relationships of macrocyclic hydroxamic acids that inhibit tumor necrosis factor alpha release in vitro and in vivo. J Med Chem. 2001 Aug 2;44(16):2636-60. | ||||
| Ref 527982 | Bioorg Med Chem Lett. 2006 Mar 15;16(6):1605-9. Epub 2006 Jan 19.Acetylenic TACE inhibitors. Part 3: Thiomorpholine sulfonamide hydroxamates. | ||||
| Ref 528025 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. | ||||
| Ref 528532 | Drug evaluation: apratastat, a novel TACE/MMP inhibitor for rheumatoid arthritis. Curr Opin Investig Drugs. 2006 Nov;7(11):1014-9. | ||||
| Ref 529102 | Bioorg Med Chem. 2008 Jan 1;16(1):530-5. Epub 2007 Sep 14.Chromen-based TNF-alpha converting enzyme (TACE) inhibitors: design, synthesis, and biological evaluation. | ||||
| Ref 529165 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):241-6. Epub 2007 Oct 30.Discovery of beta-benzamido hydroxamic acids as potent, selective, and orally bioavailable TACE inhibitors. | ||||
| Ref 529692 | Bioorg Med Chem. 2008 Oct 1;16(19):8781-94. Epub 2008 Aug 29.Specific targeting of metzincin family members with small-molecule inhibitors: progress toward a multifarious challenge. | ||||
| Ref 529876 | Bioorg Med Chem. 2009 Jan 15;17(2):444-59. Epub 2008 Dec 3.Current perspective of TACE inhibitors: a review. | ||||
| Ref 530746 | J Med Chem. 2010 Mar 25;53(6):2622-35.Potent arylsulfonamide inhibitors of tumor necrosis factor-alpha converting enzyme able to reduce activated leukocyte cell adhesion molecule shedding in cancer cell models. | ||||
| Ref 535881 | Tumour necrosis factor-alpha converting enzyme (TACE) activity in human colonic epithelial cells. Clin Exp Immunol. 2004 Jan;135(1):146-53. | ||||
| Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
| Ref 536688 | Drug insight: tumor necrosis factor-converting enzyme as a pharmaceutical target for rheumatoid arthritis. Nat Clin Pract Rheumatol. 2008 Jun;4(6):300-9. Epub 2008 Apr 15. | ||||
| Ref 538112 | The secretases that cleave angiotensin converting enzyme and the amyloid precursor protein are distinct from tumour necrosis factor-alpha convertase. FEBS Lett. 1998 Jul 10;431(1):63-5. | ||||
