Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T94033
|
||||
| Former ID |
TTDS00202
|
||||
| Target Name |
Coagulation factor IIa
|
||||
| Gene Name |
F2
|
||||
| Synonyms |
Coagulation factor II; Prothrombin; F2
|
||||
| Target Type |
Successful
|
||||
| Disease | Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | ||||
| Angina pectoris [ICD9: 413; ICD10: I20] | |||||
| Bleeding [ICD9: 444, 453; ICD10: I74, I80-I82] | |||||
| Blood coagulation disorders [ICD10: D65-D68] | |||||
| Blood forming organ disorders [ICD10: D75.9] | |||||
| Coagulation [ICD10: I80-I82] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Heart arrhythmia [ICD10: I47-I49] | |||||
| Myocardial infarction [ICD9: 410; ICD10: I21, I22] | |||||
| Nonvalvular atrial fibrillation; Thrombosis [ICD9: 427.31, 437.6, 453, 671.5, 671.9; ICD10: I48, I80-I82] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Stroke in atrial fibrillation [ICD9: 427.31, 434.91; ICD10: I48, I61-I63] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Thrombocytopenia [ICD9: 287.3, 287.4, 287.5; ICD10: D69.6, P61.0] | |||||
| Venous thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Thrombin, which cleaves bonds after arg and lys, converts fibrinogen to fibrin and activates factors v, vii, viii, xiii, and, in complex with thrombomodulin, protein c.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T94033
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.5
|
||||
| Sequence |
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY GFYTHVFRLKKWIQKVIDQFGE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Anisindione | Drug Info | Approved | Coagulation | [538440], [541995] |
| Bivalirudin | Drug Info | Approved | Thrombocytopenia | [536361], [541605] | |
| Dabigatran | Drug Info | Approved | Stroke in atrial fibrillation | [531351], [541518] | |
| Lepirudin | Drug Info | Approved | Thrombocytopenia | [536361], [541604] | |
| Hirudin | Drug Info | Phase 4 | Discovery agent | [524467] | |
| MELAGATRAN | Drug Info | Phase 3 | Discovery agent | [521709], [541520] | |
| SR-123781A | Drug Info | Phase 2/3 | Venous thrombosis | [521845] | |
| EFEGATRAN SULFATE HYDRATE | Drug Info | Phase 2 | Myocardial infarction | [527625] | |
| EP-217609 | Drug Info | Phase 2 | Thrombosis | [549210] | |
| LB-30870 | Drug Info | Phase 2 | Myocardial infarction | [551846] | |
| NU-172 | Drug Info | Phase 2 | Thrombosis | [522521] | |
| Odiparcil | Drug Info | Phase 2 | Cardiovascular disorder | [521747] | |
| Pegmusirudin | Drug Info | Phase 2 | Angina pectoris | [521580] | |
| Recombinant RGD-hirudin | Drug Info | Phase 2 | Thrombosis | [530928] | |
| AZD-8165 | Drug Info | Phase 1 | Thrombosis | [523086], [542697] | |
| DP-4088 | Drug Info | Phase 1 | Blood coagulation disorders | [548782] | |
| EP-42675 | Drug Info | Phase 1 | Thrombosis | [548235] | |
| RWJ-671818 | Drug Info | Phase 1 | Thrombosis | [530660] | |
| Solulin | Drug Info | Phase 1 | Thrombosis | [531504] | |
| SSR-128428 | Drug Info | Phase 1 | Thromboembolism | [547951] | |
| H376/95 | Drug Info | Withdrawn from market | Discovery agent | [521708] | |
| Ximelagatran | Drug Info | Withdrawn from market | Coagulation | [536361], [541519] | |
| AZD0837 | Drug Info | Discontinued in Phase 2 | Nonvalvular atrial fibrillation; Thrombosis | [542662], [547675] | |
| Dermolastin | Drug Info | Discontinued in Phase 2 | Atopic dermatitis | [547642] | |
| INOGATRAN | Drug Info | Discontinued in Phase 2 | Myocardial infarction | [545842] | |
| Napsagatran | Drug Info | Discontinued in Phase 2 | Myocardial infarction | [545647] | |
| SSR-182289 | Drug Info | Discontinued in Phase 2 | Myocardial infarction | [547360] | |
| Vasoflux | Drug Info | Discontinued in Phase 2 | Myocardial infarction | [546404] | |
| ARC-183 | Drug Info | Discontinued in Phase 1 | Blood forming organ disorders | [547835] | |
| BCX-1470 | Drug Info | Discontinued in Phase 1 | Bleeding | [546724] | |
| CJC-1004 | Drug Info | Discontinued in Phase 1 | Thrombosis | [547263] | |
| CVS-1123 | Drug Info | Discontinued in Phase 1 | Myocardial infarction | [545765] | |
| GW-473178 | Drug Info | Discontinued in Phase 1 | Heart arrhythmia | [547305] | |
| Licostinel | Drug Info | Discontinued in Phase 1 | Neurological disease | [545531] | |
| MPC-0920 | Drug Info | Discontinued in Phase 1 | Thrombosis | [548226] | |
| S-18326 | Drug Info | Discontinued in Phase 1 | Myocardial infarction | [545791] | |
| UK-156406 | Drug Info | Discontinued in Phase 1 | Myocardial infarction | [546743] | |
| BCH-2763 | Drug Info | Terminated | Thrombosis | [546230] | |
| BMS-189664 | Drug Info | Terminated | Myocardial infarction | [546805] | |
| CVS-995 | Drug Info | Terminated | Myocardial infarction | [545766] | |
| DuP 714 | Drug Info | Terminated | Thromboembolism | [545010] | |
| Efegatran | Drug Info | Terminated | Discovery agent | [545040] | |
| GS-522 | Drug Info | Terminated | Thromboembolism | [545438] | |
| Hementin | Drug Info | Terminated | Thromboembolism | [545852] | |
| L-373890 | Drug Info | Terminated | Thrombosis | [546669] | |
| L-374,087 | Drug Info | Terminated | Thrombosis | [546605] | |
| LB30057 | Drug Info | Terminated | Discovery agent | [546602] | |
| Org-34092 | Drug Info | Terminated | Thromboembolism | [546864] | |
| PPACK | Drug Info | Terminated | Discovery agent | [545056] | |
| SR-80027A | Drug Info | Terminated | Thromboembolism | [545878] | |
| Inhibitor | (3,4-dichlorophenyl)(1H-pyrazol-1-yl)methanone | Drug Info | [529037] | ||
| (3-nitro-1H-pyrazol-1-yl)(p-tolyl)methanone | Drug Info | [529037] | |||
| (3-nitro-1H-pyrazol-1-yl)(phenyl)methanone | Drug Info | [529037] | |||
| (4-bromo-1H-pyrazol-1-yl)(p-tolyl)methanone | Drug Info | [529037] | |||
| (4-nitro-1H-pyrazol-1-yl)(o-tolyl)methanone | Drug Info | [529037] | |||
| (4-nitro-1H-pyrazol-1-yl)(phenyl)methanone | Drug Info | [529037] | |||
| 1,2,3,4,6-penta-O-galloyl-beta-D-glucose | Drug Info | [534762] | |||
| 1-(HYDROXYMETHYLENEAMINO)-8-HYDROXY-OCTANE | Drug Info | [551374] | |||
| 1-benzoyl-N-phenyl-1H-pyrazole-3-carboxamide | Drug Info | [529037] | |||
| 2-(2-Hydroxy-phenyl)-1H-indole-5-carboxamidine | Drug Info | [526118] | |||
| 2-NAPHTHALENESULFONIC ACID | Drug Info | [551374] | |||
| 2-nas-phe(3-am)-4-(2-guanidinoethyl)piperidine | Drug Info | [528292] | |||
| 3-(4-HYDROXY-PHENYL)PYRUVIC ACID | Drug Info | [551374] | |||
| 3-chlorophenyl 2-oxo-2H-chromene-3-carboxylate | Drug Info | [527883] | |||
| 4-(2,5-DIAMINO-5-HYDROXY-PENTYL)-PHENOL | Drug Info | [551374] | |||
| 4-(3,4-Diethoxy-benzylamino)-benzamidine | Drug Info | [527397] | |||
| 4-(4-Benzyloxy-3-methoxy-benzylamino)-benzamidine | Drug Info | [527397] | |||
| 4-Iodobenzo[B]Thiophene-2-Carboxamidine | Drug Info | [551374] | |||
| 4-TERT-BUTYLBENZENESULFONIC ACID | Drug Info | [551374] | |||
| 4-[3-(4-CHLOROPHENYL)-1H-PYRAZOL-5-YL]PIPERIDINE | Drug Info | [551374] | |||
| 5-desgalloylstachyurin | Drug Info | [534762] | |||
| 6-(2-HYDROXY-CYCLOPENTYL)-7-OXO-HEPTANAMIDINE | Drug Info | [551374] | |||
| AC-(D)PHE-PRO-BOROHOMOLYS-OH | Drug Info | [551374] | |||
| AC-(D)PHE-PRO-BOROHOMOORNITHINE-OH | Drug Info | [551374] | |||
| AC-(D)PHE-PRO-BOROLYS-OH | Drug Info | [551374] | |||
| AZD-8165 | Drug Info | [543606] | |||
| AZD0837 | Drug Info | [550288] | |||
| Bbs-Arg-(D-Pip)-Gly-(EQKLISEEDL)-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-(SPH(pY)EKVS)-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-(SPHYEKVS)-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)1-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)11-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)13-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)3-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)5-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)7-Gly-Hir | Drug Info | [527780] | |||
| Bbs-Arg-(D-Pip)-Gly-S-(GS)9-Gly-Hir | Drug Info | [527780] | |||
| BCH-2763 | Drug Info | [538083] | |||
| BCX-1470 | Drug Info | [544115] | |||
| BENZOTHIAZOLE | Drug Info | [551374] | |||
| Beta-(2-Naphthyl)-Alanine | Drug Info | [551374] | |||
| Beta-phenyl-D-phenylalanyl-N-propyl-L-prolinamide | Drug Info | [551374] | |||
| Bivalirudin | Drug Info | [535224] | |||
| Bivalirudine | Drug Info | [535345] | |||
| BMS-189664 | Drug Info | [551871] | |||
| BMS-344577 | Drug Info | [530503] | |||
| BMS-740808 | Drug Info | [529194] | |||
| CASUARIIN | Drug Info | [534762] | |||
| CHLORODYSINOSIN A | Drug Info | [530312] | |||
| CJC-1004 | Drug Info | [526666] | |||
| COCHINCHINENENE B | Drug Info | [529057] | |||
| COCHINCHINENIN B | Drug Info | [529057] | |||
| CRA_8696 | Drug Info | [551374] | |||
| CVS-1123 | Drug Info | [534333] | |||
| CVS-995 | Drug Info | [534248] | |||
| Cyclotheonamide E | Drug Info | [526298] | |||
| Cyclotheonamide E4 | Drug Info | [526298] | |||
| Cyclotheonamide E5 | Drug Info | [526298] | |||
| D-leucyl-N-(3-chlorobenzyl)-L-prolinamide | Drug Info | [551374] | |||
| D-leucyl-N-(4-carbamimidoylbenzyl)-L-prolinamide | Drug Info | [551374] | |||
| D-phenylalanyl-N-(3-chlorobenzyl)-L-prolinamide | Drug Info | [551374] | |||
| D-phenylalanyl-N-(3-fluorobenzyl)-L-prolinamide | Drug Info | [551374] | |||
| D-phenylalanyl-N-(3-methylbenzyl)-L-prolinamide | Drug Info | [551374] | |||
| D-phenylalanyl-N-benzyl-L-prolinamide | Drug Info | [551374] | |||
| D-Pro-Phe-Arg chloromethyl ketone | Drug Info | [529454] | |||
| Dabigatran | Drug Info | [531351] | |||
| Dermolastin | Drug Info | [536190], [536840], [537435], [551533] | |||
| Desirudine | Drug Info | [535345] | |||
| DP-4088 | Drug Info | [543606] | |||
| DuP 714 | Drug Info | [535205] | |||
| DYSINOSIN A | Drug Info | [530312] | |||
| Efegatran | Drug Info | [535205] | |||
| EFEGATRAN SULFATE HYDRATE | Drug Info | [551871] | |||
| Enoxaprin | Drug Info | [537910] | |||
| Gamma-Carboxy-Glutamic Acid | Drug Info | [551393] | |||
| GR-133686 | Drug Info | [534803] | |||
| GS-522 | Drug Info | [534196] | |||
| GW-473178 | Drug Info | [547306] | |||
| H376/95 | Drug Info | [535224] | |||
| Haempatch | Drug Info | [543606] | |||
| Hementin | Drug Info | [533550] | |||
| Hemi-Babim | Drug Info | [551374] | |||
| Heparin-Cantithrombin III | Drug Info | [535514] | |||
| Hirudin | Drug Info | [535224], [535605], [538091] | |||
| Hirulog | Drug Info | [538091] | |||
| L-370,518 | Drug Info | [538091] | |||
| L-373890 | Drug Info | [534784] | |||
| L-374,087 | Drug Info | [535728] | |||
| L-375378 | Drug Info | [526487] | |||
| LB-30870 | Drug Info | [551871] | |||
| LB30057 | Drug Info | [535684] | |||
| LB30812 | Drug Info | [535774] | |||
| Lepirudin | Drug Info | [534921] | |||
| Lepirudine | Drug Info | [535345] | |||
| Licostinel | Drug Info | [535658] | |||
| Lysophosphotidylserine | Drug Info | [551393] | |||
| Macrocyclic tripeptide motif | Drug Info | [551309] | |||
| MELAGATRAN | Drug Info | [528017] | |||
| Melogatran | Drug Info | [535514] | |||
| Methyl L-phenylalaninate | Drug Info | [551374] | |||
| METHYL-PHE-PRO-AMINO-CYCLOHEXYLGLYCINE | Drug Info | [551374] | |||
| MPC-0920 | Drug Info | [549865] | |||
| N4-(N,N-DIPHENYLCARBAMOYL)-AMINOGUANIDINE | Drug Info | [551374] | |||
| Napsagatran | Drug Info | [534111] | |||
| NU-172 | Drug Info | [544213], [551844] | |||
| Odiparcil | Drug Info | [528425] | |||
| Org-34092 | Drug Info | [543606] | |||
| OSCILLARIN | Drug Info | [530312] | |||
| PEDUNCULAGIN | Drug Info | [534762] | |||
| PPACK | Drug Info | [535205] | |||
| RAZAXABAN | Drug Info | [530655] | |||
| RWJ-50353 | Drug Info | [529193] | |||
| S-18326 | Drug Info | [551871] | |||
| S-2238 | Drug Info | [535151] | |||
| SC-79407 | Drug Info | [535728] | |||
| SR-80027A | Drug Info | [533808] | |||
| SSR-182289 | Drug Info | [551871] | |||
| Tellimagrandin II | Drug Info | [534762] | |||
| UK-156406 | Drug Info | [551871] | |||
| Vasoflux | Drug Info | [534833] | |||
| VE-04051645 | Drug Info | [543606] | |||
| Ximelagatran | Drug Info | [537615] | |||
| Modulator | Anisindione | Drug Info | [535724] | ||
| bufrudin, Biopharm | Drug Info | ||||
| CVS-1578 | Drug Info | ||||
| EP-217609 | Drug Info | ||||
| EP-42675 | Drug Info | [532552] | |||
| INOGATRAN | Drug Info | ||||
| Pegmusirudin | Drug Info | [543606] | |||
| Recombinant RGD-hirudin | Drug Info | [528917] | |||
| RWJ-671818 | Drug Info | [530660] | |||
| Solulin | Drug Info | [531504] | |||
| SR-123781A | Drug Info | [535183] | |||
| SSR-128428 | Drug Info | ||||
| TB-101 | Drug Info | [543606] | |||
| TB-102 | Drug Info | [543606] | |||
| Tumor vascular thrombogen | Drug Info | [543606] | |||
| Cofactor | Vitamin K | Drug Info | [537752] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Complement and coagulation cascades | |||||
| Regulation of actin cytoskeleton | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | Blood coagulation | ||||
| Pathway Interaction Database | Thrombin/protease-activated receptor (PAR) pathway | ||||
| Angiopoietin receptor Tie2-mediated signaling | |||||
| FOXA2 and FOXA3 transcription factor networks | |||||
| PAR4-mediated thrombin signaling events | |||||
| Syndecan-4-mediated signaling events | |||||
| PAR1-mediated thrombin signaling events | |||||
| PathWhiz Pathway | Vitamin K Metabolism | ||||
| Coagulation | |||||
| Reactome | Intrinsic Pathway of Fibrin Clot Formation | ||||
| Common Pathway of Fibrin Clot Formation | |||||
| Gamma-carboxylation of protein precursors | |||||
| Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus | |||||
| Removal of aminoterminal propeptides from gamma-carboxylated proteins | |||||
| Cell surface interactions at the vascular wall | |||||
| Peptide ligand-binding receptors | |||||
| Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) | |||||
| G alpha (q) signalling events | |||||
| Thrombin signalling through proteinase activated receptors (PARs) | |||||
| WikiPathways | Complement and Coagulation Cascades | ||||
| Regulation of Actin Cytoskeleton | |||||
| IL1 and megakaryotyces in obesity | |||||
| Regulation of Insulin-like Growth Factor (IGF) Transport and Uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) | |||||
| gamma carboxylation, hypusine formation and arylsulfatase activation | |||||
| Blood Clotting Cascade | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Thrombin signalling through proteinase activated receptors (PARs) | |||||
| Platelet Aggregation (Plug Formation) | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| Formation of Fibrin Clot (Clotting Cascade) | |||||
| Cell surface interactions at the vascular wall | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| References | |||||
| Ref 521580 | ClinicalTrials.gov (NCT00074620) A Clinical Study to Assess the Safety of PEG-Hirudin (SPP200) Compared to Heparin in Patients Who Are on Haemodialysis. U.S. National Institutes of Health. | ||||
| Ref 521708 | ClinicalTrials.gov (NCT00206063) Long Term Open Follow-up With H376/95 vs. Warfarin. U.S. National Institutes of Health. | ||||
| Ref 521709 | ClinicalTrials.gov (NCT00206089) Melagatran/Ximelagatran Versus Enoxaparin for the Prevention of Venous Thromboembolic Events. U.S. National Institutes of Health. | ||||
| Ref 521747 | ClinicalTrials.gov (NCT00240643) Use Of SB424323 With Aspirin In Non-Valvular Atrial Fibrillation In Patients At A Low Or Intermediate Risk For Stroke. U.S. National Institutes of Health. | ||||
| Ref 521845 | ClinicalTrials.gov (NCT00338897) Dose Ranging Study in Elective Total Hip Replacement Surgery. U.S. National Institutes of Health. | ||||
| Ref 522521 | ClinicalTrials.gov (NCT00808964) Study of NU172 as Anticoagulation in Patients Undergoing Off-pump CABG Surgery. U.S. National Institutes of Health. | ||||
| Ref 523086 | ClinicalTrials.gov (NCT01150812) Oral AZD8165 After Single Oral Ascending Doses in Healthy Male Subjects. U.S. National Institutes of Health. | ||||
| Ref 524467 | ClinicalTrials.gov (NCT01960569) Topical r-Hirudin ( Thrombexx ) Efficacy in Treatment of Haematomas. U.S. National Institutes of Health. | ||||
| Ref 530660 | J Med Chem. 2010 Feb 25;53(4):1843-56.Discovery and clinical evaluation of 1-{N-[2-(amidinoaminooxy)ethyl]amino}carbonylmethyl-6-methyl-3-[2,2-difluoro-2-phenylethylamino]pyrazinone (RWJ-671818), a thrombin inhibitor with an oxyguanidine P1 motif. | ||||
| Ref 530928 | The antithrombotic effect of a novel hirudin derivative after reconstruction of carotid artery in rabbits. Thromb Res. 2010 Oct;126(4):e339-43. | ||||
| Ref 531504 | The thrombomodulin analog Solulin promotes reperfusion and reduces infarct volume in a thrombotic stroke model. J Thromb Haemost. 2011 Jun;9(6):1174-82. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 538440 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010909. | ||||
| Ref 541518 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6380). | ||||
| Ref 541519 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6381). | ||||
| Ref 541520 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6382). | ||||
| Ref 541604 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6469). | ||||
| Ref 541605 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6470). | ||||
| Ref 541995 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6960). | ||||
| Ref 542662 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7682). | ||||
| Ref 542697 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7727). | ||||
| Ref 545010 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001867) | ||||
| Ref 545040 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001951) | ||||
| Ref 545056 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001987) | ||||
| Ref 545438 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003259) | ||||
| Ref 545531 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003616) | ||||
| Ref 545647 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004026) | ||||
| Ref 545765 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004614) | ||||
| Ref 545766 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004615) | ||||
| Ref 545791 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004736) | ||||
| Ref 545842 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005012) | ||||
| Ref 545852 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005051) | ||||
| Ref 545878 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005178) | ||||
| Ref 546230 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007017) | ||||
| Ref 546404 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007938) | ||||
| Ref 546602 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009139) | ||||
| Ref 546605 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009151) | ||||
| Ref 546669 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009558) | ||||
| Ref 546724 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009938) | ||||
| Ref 546743 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010067) | ||||
| Ref 546805 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010403) | ||||
| Ref 546864 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010730) | ||||
| Ref 547263 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014574) | ||||
| Ref 547305 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015039) | ||||
| Ref 547360 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015478) | ||||
| Ref 547642 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018071) | ||||
| Ref 547675 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018351) | ||||
| Ref 547835 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019755) | ||||
| Ref 547951 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020651) | ||||
| Ref 548226 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023381) | ||||
| Ref 548235 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023539) | ||||
| Ref 548782 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028740) | ||||
| Ref 526118 | J Med Chem. 2001 Aug 16;44(17):2753-71.Development of serine protease inhibitors displaying a multicentered short (<2.3 A) hydrogen bond binding mode: inhibitors of urokinase-type plasminogen activator and factor Xa. | ||||
| Ref 526298 | J Nat Prod. 2002 Mar;65(3):259-61.Cyclotheonamide E4 and E5, new potent tryptase inhibitors from an Ircinia species of sponge. | ||||
| Ref 526487 | Bioorg Med Chem Lett. 2003 Jan 20;13(2):161-4.Small, low nanomolar, noncovalent thrombin inhibitors lacking a group to fill the 'distal binding pocket'. | ||||
| Ref 527397 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):817-22.Design of selective phenylglycine amide tissue factor/factor VIIa inhibitors. | ||||
| Ref 527780 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5120-3. Epub 2005 Oct 3.Transforming bivalent ligands into retractable enzyme inhibitors through polypeptide-protein interactions. | ||||
| Ref 527883 | J Med Chem. 2005 Dec 1;48(24):7592-603.3,6-disubstituted coumarins as mechanism-based inhibitors of thrombin and factor Xa. | ||||
| Ref 528017 | Bioorg Med Chem Lett. 2006 May 15;16(10):2648-53. Epub 2006 Feb 3.Orally active thrombin inhibitors. Part 2: optimization of the P2-moiety. | ||||
| Ref 528292 | J Med Chem. 2006 Jul 13;49(14):4116-26.Secondary amides of sulfonylated 3-amidinophenylalanine. New potent and selective inhibitors of matriptase. | ||||
| Ref 528425 | A comparison of the beta-D-xyloside, odiparcil, to warfarin in a rat model of venous thrombosis. J Thromb Haemost. 2006 Sep;4(9):1989-96. | ||||
| Ref 528917 | The NMR solution structure of recombinant RGD-hirudin. Biochem Biophys Res Commun. 2007 Aug 17;360(1):103-8. Epub 2007 Jun 13. | ||||
| Ref 529037 | J Med Chem. 2007 Oct 4;50(20):4928-38. Epub 2007 Sep 12.N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. | ||||
| Ref 529057 | J Nat Prod. 2007 Oct;70(10):1570-7. Epub 2007 Sep 21.Anti-Helicobacter pylori and thrombin inhibitory components from Chinese dragon's blood, Dracaena cochinchinensis. | ||||
| Ref 529193 | Bioorg Med Chem. 2008 Feb 15;16(4):1562-95. Epub 2007 Nov 6.Inhibitors of proteases and amide hydrolases that employ an alpha-ketoheterocycle as a key enabling functionality. | ||||
| Ref 529194 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):749-54. Epub 2007 Nov 17.Structure-activity relationship and pharmacokinetic profile of 5-ketopyrazole factor Xa inhibitors. | ||||
| Ref 529454 | J Med Chem. 2008 Jun 12;51(11):3077-80. Epub 2008 May 7.Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors. | ||||
| Ref 530312 | Bioorg Med Chem Lett. 2009 Sep 15;19(18):5429-32. Epub 2009 Jul 26.From natural products to achiral drug prototypes: potent thrombin inhibitors based on P2/P3 dihydropyrid-2-one core motifs. | ||||
| Ref 530503 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6882-9. Epub 2009 Oct 23.Aroylguanidine-based factor Xa inhibitors: the discovery of BMS-344577. | ||||
| Ref 530655 | Bioorg Med Chem Lett. 2010 Feb 15;20(4):1373-7. Epub 2010 Jan 11.Phenyltriazolinones as potent factor Xa inhibitors. | ||||
| Ref 530660 | J Med Chem. 2010 Feb 25;53(4):1843-56.Discovery and clinical evaluation of 1-{N-[2-(amidinoaminooxy)ethyl]amino}carbonylmethyl-6-methyl-3-[2,2-difluoro-2-phenylethylamino]pyrazinone (RWJ-671818), a thrombin inhibitor with an oxyguanidine P1 motif. | ||||
| Ref 531504 | The thrombomodulin analog Solulin promotes reperfusion and reduces infarct volume in a thrombotic stroke model. J Thromb Haemost. 2011 Jun;9(6):1174-82. | ||||
| Ref 531826 | A high affinity, antidote-controllable prothrombin and thrombin-binding RNA aptamer inhibits thrombin generation and thrombin activity. J Thromb Haemost. 2012 May;10(5):870-80. | ||||
| Ref 532552 | EP42675, a synthetic parenteral dual-action anticoagulant: pharmacokinetics, pharmacodynamics, and absence of interactions with antiplatelet drugs. J Thromb Haemost. 2014 Jan;12(1):24-33. | ||||
| Ref 533550 | Hementin: anticoagulant protease from the salivary gland of the leech Haementeria ghilianii. J Lab Clin Med. 1984 Jan;103(1):44-58. | ||||
| Ref 533808 | Pharmacokinetic and antithrombotic properties of two pentasaccharides with high affinity to antithrombin III in the rabbit: comparison with CY216. Blood. 1994 Oct 15;84(8):2571-7. | ||||
| Ref 534111 | Effects of napsagatran (Ro 46-6240), a new synthetic thrombin inhibitor and of heparin in a canine model of coronary artery thrombosis: comparison with an ex vivo annular perfusion chamber model. J Pharmacol Exp Ther. 1996 Apr;277(1):71-8. | ||||
| Ref 534196 | A novel oligodeoxynucleotide inhibitor of thrombin. I. In vitro metabolic stability in plasma and serum. Pharm Res. 1995 Dec;12(12):1937-42. | ||||
| Ref 534248 | Synthesis, structure, and structure-activity relationships of divalent thrombin inhibitors containing an alpha-keto-amide transition-state mimetic. Protein Sci. 1996 Mar;5(3):422-33. | ||||
| Ref 534333 | CVS-1123, a direct thrombin inhibitor, prevents occlusive arterial and venous thrombosis in a canine model of vascular injury. J Cardiovasc Pharmacol. 1997 Feb;29(2):240-9. | ||||
| Ref 534762 | J Nat Prod. 1998 Nov;61(11):1356-60.Effects of tannins from Geum japonicum on the catalytic activity of thrombin and factor Xa of blood coagulation cascade. | ||||
| Ref 534784 | L-374,087, an efficacious, orally bioavailable, pyridinone acetamide thrombin inhibitor. Bioorg Med Chem Lett. 1998 Apr 7;8(7):817-22. | ||||
| Ref 534803 | Bioorg Med Chem Lett. 1998 Nov 3;8(21):2955-60.5,5-trans lactone-containing inhibitors of serine proteases: identification of a novel, acylating thrombin inhibitor. | ||||
| Ref 534833 | Vasoflux, a new anticoagulant with a novel mechanism of action. Circulation. 1999 Feb 9;99(5):682-9. | ||||
| Ref 534921 | Recombinant hirudin (lepirudin) as anticoagulant in intensive care patients treated with continuous hemodialysis. Kidney Int Suppl. 1999 Nov;(72):S46-50. | ||||
| Ref 535151 | Screening for selective thrombin inhibitors in mushrooms. Blood Coagul Fibrinolysis. 2001 Mar;12(2):123-8. | ||||
| Ref 535345 | New antithrombotic drugs (excluding plasminogen activators. Arch Mal Coeur Vaiss. 2001 Nov;94(11 Suppl):1225-32. | ||||
| Ref 535514 | Thrombin inhibitors in acute coronary artery disease. Eur Heart J. 2002 Aug;23(15):1142-4. | ||||
| Ref 535605 | Probing the hirudin-thrombin interaction by incorporation of noncoded amino acids and molecular dynamics simulation. Biochemistry. 2002 Nov 19;41(46):13556-69. | ||||
| Ref 535658 | Neuroprotective agents for the treatment of acute ischemic stroke. Curr Neurol Neurosci Rep. 2003 Jan;3(1):9-20. | ||||
| Ref 535684 | Antithrombotic activity of LB30057, a newly synthesized direct thrombin inhibitor. Thromb Haemost. 2003 Jan;89(1):104-11. | ||||
| Ref 535724 | Anticoagulation with anisindione in a patient with a warfarin-induced skin eruption. Pharmacotherapy. 2003 Apr;23(4):533-6. | ||||
| Ref 535728 | Pharmacological intervention at disparate sites in the coagulation cascade: comparison of anti-thrombotic efficacy vs bleeding propensity in a rat model of acute arterial thrombosis. J Thromb Thrombolysis. 2002 Oct;14(2):113-21. | ||||
| Ref 535774 | Efficacious and orally bioavailable thrombin inhibitors based on a 2,5-thienylamidine at the P1 position: discovery of N-carboxymethyl-d-diphenylalanyl-l-prolyl[(5-amidino-2-thienyl)methyl]amide. J Med Chem. 2003 Aug 14;46(17):3612-22. | ||||
| Ref 536840 | Bioreactor strategies for improving production yield and functionality of a recombinant human protein in transgenic tobacco cell cultures. Biotechnol Bioeng. 2009 Feb 1;102(2):508-20. | ||||
| Ref 537435 | Optimization of the bioprocessing conditions for scale-up of transient production of a heterologous protein in plants using a chemically inducible viral amplicon expression system. Biotechnol Prog. 2009 May-Jun;25(3):722-34. | ||||
| Ref 537615 | Ximelagatran increases membrane fluidity and changes membrane lipid composition in primary human hepatocytes. Toxicol In Vitro. 2009 Jul 16. | ||||
| Ref 537752 | Plasma levels of protein C and vitamin K-dependent coagulation factors in patients on long-term oral anticoagulant therapy. Tohoku J Exp Med. 1986 Aug;149(4):351-7. | ||||
| Ref 537910 | Low molecular weight heparins and their use in obstetrics and gynecology. Obstet Gynecol Surv. 1994 Jun;49(6):424-31. | ||||
| Ref 538083 | BCH-2763, a novel potent parenteral thrombin inhibitor, is an effective antithrombotic agent in rodent models of arterial and venous thrombosis--comparisons with heparin, r-hirudin, hirulog, inogatran and argatroban. Thromb Haemost. 1998 Feb;79(2):431-8. | ||||
| Ref 538091 | Assessment of thrombin inhibitor efficacy in a novel rabbit model of simultaneous arterial and venous thrombosis. Thromb Haemost. 1998 Mar;79(3):656-62. | ||||
| Ref 543606 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2362). | ||||
| Ref 544115 | Recent Developments in Low Molecular Weight Complement Inhibitors. Mol Immunol. 2009 December; 47(2-3): 185-195. | ||||
| Ref 544213 | Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011; 18(27): 4206-4214. | ||||
| Ref 547306 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015039) | ||||
| Ref 551309 | Novel thrombin inhibitors that are based on a macrocyclic tripeptide motif, Bioorg. Med. Chem. Lett. 6(24):2947-2952 (1996). | ||||
