Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE0P6LK)

DME Name Sulfotransferase 2A1 (SULT2A1)
Synonyms Sulfotransferase family cytosolic 2A member 1; Bile salt sulfotransferase; Dehydroepiandrosterone sulfotransferase; Hydroxysteroid Sulfotransferase; DHEA-ST; HST; ST2; ST2A1; ST2A3; STD; SULT2A1
Gene Name SULT2A1
UniProt ID
ST2A1_HUMAN
INTEDE ID
DME0074
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6822
EC Number EC: 2.8.2.14
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.14
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Function This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands.
KEGG Pathway
Bile secretion (hsa04976 )
Chemical carcinogenesis (hsa05204 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Reactome Pathway
PPARA activates gene expression (R-HSA-1989781 )
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
5 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Abiraterone acetate DMANBZI Prostate cancer 2C82.0 Approved [1]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [2]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved []
Vonoprazan DMO6315 Helicobacter infection DA42-DA63 Approved [3]
Pregnenolone DM6VFO1 Schizophrenia 6A20 Phase 4 [4]
3 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ASP-015K DMZ1UOI Psoriasis vulgaris EA90 Phase 3 [5]
Genistein DM0JETC Menopause symptom GA30.0 Phase 2/3 [2]
BCP-13498 DM2BO9W N. A. N. A. Phase 2 [6]
4 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
bisphenol A DM2ZLD7 Discovery agent N.A. Investigative [2]
daidzein DMRFTJX Discovery agent N.A. Investigative [2]
N-nonylphenol DMH3OUX N. A. N. A. Investigative [2]
Tetramethylbutylphenol DMW9CH2 N. A. N. A. Investigative [2]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
bisphenol A Discovery agent [N.A.] Investigative Km = 0.0043 microM [2]
daidzein Discovery agent [N.A.] Investigative Km = 0.1673 microM [2]
Genistein Menopause symptom [GA30.0] Phase 2/3 Km = 0.041 microM [2]
Pregnenolone Schizophrenia [6A20] Phase 4 Km = 0.0018 microM [4]
Prasterone Chronic obstructive pulmonary disease [CA22] Approved Km = 0.002 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.40E-01 7.30E-03 5.99E-02
Alopecia ED70 Skin from scalp 4.86E-01 -1.57E-03 -1.13E-02
Alzheimer's disease 8A20 Entorhinal cortex 6.93E-01 1.35E-02 1.35E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.96E-01 -8.89E-03 -1.34E-01
Aortic stenosis BB70 Calcified aortic valve 4.67E-01 1.12E-02 4.43E-02
Apnea 7A40 Hyperplastic tonsil 3.03E-01 5.72E-02 1.22E+00
Arthropathy FA00-FA5Z Peripheral blood 9.72E-01 -1.83E-02 -2.54E-01
Asthma CA23 Nasal and bronchial airway 7.41E-01 3.50E-02 1.90E-01
Atopic dermatitis EA80 Skin 1.92E-01 5.90E-03 7.04E-02
Autism 6A02 Whole blood 3.02E-01 -4.34E-02 -2.73E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.49E-01 -1.36E-01 -3.28E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.65E-02 1.16E-01 1.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.62E-01 -2.22E-04 -1.66E-03
Batten disease 5C56.1 Whole blood 1.51E-01 5.79E-02 4.26E-01
Behcet's disease 4A62 Peripheral blood 5.24E-01 3.05E-02 2.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.03E-01 -1.20E-02 -1.36E-01
Bladder cancer 2C94 Bladder tissue 9.20E-03 -1.69E+00 -1.84E+00
Breast cancer 2C60-2C6Z Breast tissue 8.40E-01 5.46E-03 3.67E-02
Cardioembolic stroke 8B11.20 Whole blood 1.28E-01 -3.85E-02 -2.15E-01
Cervical cancer 2C77 Cervical tissue 9.16E-01 1.63E-02 9.25E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.23E-01 -2.15E-02 -1.58E-01
Chronic hepatitis C 1E51.1 Whole blood 2.31E-01 4.25E-02 3.51E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.94E-01 -5.73E-03 -5.54E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.75E-02 5.21E-02 5.27E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.66E-02 -4.11E-02 -2.33E-01
Colon cancer 2B90 Colon tissue 6.39E-03 5.04E-02 9.11E-02
Coronary artery disease BA80-BA8Z Peripheral blood 9.10E-01 -4.41E-03 -2.73E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.80E-01 2.57E-02 1.95E-01
Endometriosis GA10 Endometrium tissue 1.69E-01 2.53E-02 2.76E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.46E-01 -2.06E-02 -1.87E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.64E-02 -1.71E-01 -9.75E-01
Gastric cancer 2B72 Gastric tissue 2.32E-01 -2.74E+00 -1.36E+00
Glioblastopma 2A00.00 Nervous tissue 5.97E-02 -3.63E-03 -2.13E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.98E-01 -1.15E-01 -4.65E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.54E-03 -1.36E-01 -7.81E-01
Head and neck cancer 2D42 Head and neck tissue 8.66E-01 -1.34E-02 -1.40E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.14E-01 -1.87E-02 -1.47E-01
Huntington's disease 8A01.10 Whole blood 4.44E-01 2.61E-02 3.14E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.65E-01 -7.99E-02 -9.24E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.36E-01 -2.64E-02 -2.75E-01
Influenza 1E30 Whole blood 4.16E-02 1.17E-01 9.72E-01
Interstitial cystitis GC00.3 Bladder tissue 4.63E-03 -2.05E+00 -2.72E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.71E-01 -3.39E-02 -4.19E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.09E-01 -2.05E-02 -2.73E-02
Ischemic stroke 8B11 Peripheral blood 1.90E-01 6.53E-02 6.86E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.41E-02 8.63E-02 5.50E-01
Lateral sclerosis 8B60.4 Skin 7.97E-01 -2.86E-04 -2.83E-03
Lateral sclerosis 8B60.4 Cervical spinal cord 9.94E-01 8.55E-02 3.65E-01
Liver cancer 2C12.0 Liver tissue 1.80E-17 -4.17E-01 -8.71E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.13E-02 -3.93E+00 -8.07E+00
Lung cancer 2C25 Lung tissue 2.48E-06 5.15E-02 4.42E-01
Lupus erythematosus 4A40 Whole blood 5.18E-01 -2.09E-03 -7.61E-03
Major depressive disorder 6A70-6A7Z Hippocampus 6.74E-01 -3.14E-02 -3.11E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.96E-01 -1.12E-02 -5.63E-02
Melanoma 2C30 Skin 1.59E-01 -1.03E-01 -1.85E-01
Multiple myeloma 2A83.1 Peripheral blood 5.88E-01 3.51E-02 3.36E-01
Multiple myeloma 2A83.1 Bone marrow 2.71E-04 -2.83E-01 -2.39E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.76E-01 2.62E-02 1.37E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.03E-01 3.92E-03 3.91E-02
Myelofibrosis 2A20.2 Whole blood 1.37E-02 1.50E-01 1.43E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.58E-01 4.95E-02 6.34E-02
Myopathy 8C70.6 Muscle tissue 5.88E-02 -8.48E-02 -7.20E-01
Neonatal sepsis KA60 Whole blood 2.11E-01 -6.17E-02 -3.12E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.73E-01 -1.11E-01 -7.20E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.59E-02 -6.06E-01 -1.37E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.67E-01 -7.00E-02 -9.87E-01
Olive pollen allergy CA08.00 Peripheral blood 8.14E-01 -3.28E-02 -2.11E-01
Oral cancer 2B6E Oral tissue 7.78E-05 -1.77E-01 -1.00E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.93E-02 -1.21E-01 -1.06E+00
Osteoporosis FB83.1 Bone marrow 3.09E-01 6.98E-02 6.19E-01
Ovarian cancer 2C73 Ovarian tissue 4.06E-01 3.22E-03 1.08E-02
Pancreatic cancer 2C10 Pancreas 1.70E-01 -8.74E-02 -4.07E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.98E-02 -9.34E-02 -6.95E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.50E-01 -2.98E-02 -3.78E-01
Pituitary cancer 2D12 Pituitary tissue 7.87E-01 5.03E-02 2.87E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.33E-01 5.36E-02 3.41E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.90E-02 7.11E-02 9.12E-01
Polycythemia vera 2A20.4 Whole blood 1.69E-12 1.66E-01 1.79E+00
Pompe disease 5C51.3 Biceps muscle 3.26E-02 -7.53E-02 -6.25E-01
Preterm birth KA21.4Z Myometrium 1.78E-01 4.69E-02 5.28E-01
Prostate cancer 2C82 Prostate 2.90E-03 -2.24E-01 -1.19E+00
Psoriasis EA90 Skin 4.06E-06 -1.29E-01 -5.63E-01
Rectal cancer 2B92 Rectal colon tissue 2.54E-01 -3.50E-01 -6.44E-01
Renal cancer 2C90-2C91 Kidney 4.13E-01 -1.07E-01 -7.80E-01
Retinoblastoma 2D02.2 Uvea 5.94E-01 -2.94E-02 -2.10E-01
Rheumatoid arthritis FA20 Synovial tissue 2.89E-04 -1.73E-01 -2.18E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.74E-01 3.88E-03 4.96E-02
Schizophrenia 6A20 Prefrontal cortex 7.80E-01 -1.17E-03 -9.90E-03
Schizophrenia 6A20 Superior temporal cortex 1.01E-01 -1.06E-02 -1.31E-01
Scleroderma 4A42.Z Whole blood 1.63E-01 -1.02E-01 -8.24E-01
Seizure 8A60-8A6Z Whole blood 9.33E-01 3.94E-02 2.48E-01
Sensitive skin EK0Z Skin 7.33E-01 -4.22E-02 -4.79E-01
Sepsis with septic shock 1G41 Whole blood 4.28E-01 -6.84E-03 -3.58E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.15E-01 1.00E-01 6.45E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.05E-02 1.03E-01 8.41E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.86E-01 1.44E-02 2.33E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.00E-01 -3.74E-02 -3.85E-01
Skin cancer 2C30-2C3Z Skin 1.36E-06 -1.14E-01 -4.19E-01
Thrombocythemia 3B63 Whole blood 1.87E-04 1.60E-01 1.75E+00
Thrombocytopenia 3B64 Whole blood 4.28E-01 -5.27E-02 -6.15E-01
Thyroid cancer 2D10 Thyroid 8.58E-01 1.65E-03 9.53E-03
Tibial muscular dystrophy 8C75 Muscle tissue 6.05E-02 -4.22E-02 -5.22E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.38E-01 2.40E-02 3.12E-01
Type 2 diabetes 5A11 Liver tissue 4.20E-01 1.91E-01 5.09E-01
Ureter cancer 2C92 Urothelium 9.69E-01 -4.20E-02 -2.86E-01
Uterine cancer 2C78 Endometrium tissue 9.64E-05 4.46E-02 3.31E-01
Vitiligo ED63.0 Skin 2.39E-01 -7.09E-02 -8.42E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Abiraterone for the treatment of metastatic castrate-resistant prostate cancer. Ann Pharmacother. 2012 Jul-Aug;46(7-8):1016-24.
2 Sulfation of environmental estrogens by cytosolic human sulfotransferases. Drug Metab Pharmacokinet. 2002;17(3):221-8.
3 In vitro metabolism of TAK-438, vonoprazan fumarate, a novel potassium-competitive acid blocker. Xenobiotica. 2017 Dec;47(12):1027-1034.
4 Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b). J Steroid Biochem Mol Biol. 2001 Jun;77(4-5):261-9.
5 Human mass balance, metabolite profile and identification of metabolic enzymes of [14C]ASP015K, a novel oral janus kinase inhibitor. Xenobiotica. 2015;45(10):887-902.
6 Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects. Birth Defects Res A Clin Mol Teratol. 2008 Mar;82(3):155-65.