Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE1DOKJ)

DME Name Cytosolic 5'-nucleotidase II (NT5C2)
Synonyms Cytosolic purine 5'-nucleotidase; NT5B; NT5C2; NT5CP; PNT5
Gene Name NT5C2
UniProt ID
5NTC_HUMAN
INTEDE ID
DME0482
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
22978
EC Number EC: 3.1.3.5
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV
CAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTS
CETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMK
EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
PQEITHCHDEDDDEEEEEEEE
Function This enzyme preferentially hydrolyzes inosine 5'-monophosphate (IMP) and other purine nucleotides.
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Purine metabolism (hsa00230 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Purine catabolism (R-HSA-74259 )
Abacavir metabolism (R-HSA-2161541 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ribavirin DMEYLH9 Hepatitis C virus infection 1E51.1 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Inosine DMY65AR N. A. N. A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Ribavirin Hepatitis C virus infection [1E51.1] Approved Km = 0.024 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.82E-01 2.07E-02 9.93E-02
Alopecia ED70 Skin from scalp 3.43E-01 -2.71E-02 -1.76E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.84E-06 1.16E-01 6.81E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.92E-01 9.10E-02 6.52E-01
Aortic stenosis BB70 Calcified aortic valve 6.36E-01 -8.29E-02 -2.71E-01
Apnea 7A40 Hyperplastic tonsil 5.03E-01 5.80E-01 3.44E+00
Arthropathy FA00-FA5Z Peripheral blood 2.85E-02 1.63E-01 1.05E+00
Asthma CA23 Nasal and bronchial airway 3.40E-02 3.58E-02 1.37E-01
Atopic dermatitis EA80 Skin 5.46E-04 1.25E-01 9.03E-01
Autism 6A02 Whole blood 3.24E-02 5.51E-02 3.23E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.37E-01 3.94E-04 3.14E-03
Autosomal dominant monocytopenia 4B04 Whole blood 4.64E-01 -2.24E-02 -1.38E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.61E-01 -1.41E-02 -6.47E-02
Batten disease 5C56.1 Whole blood 1.78E-01 -6.64E-02 -5.31E-01
Behcet's disease 4A62 Peripheral blood 2.38E-01 -4.69E-02 -5.11E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.94E-01 4.57E-02 3.46E-01
Bladder cancer 2C94 Bladder tissue 2.08E-01 -1.59E-01 -5.92E-01
Breast cancer 2C60-2C6Z Breast tissue 5.03E-08 9.24E-02 4.31E-01
Cardioembolic stroke 8B11.20 Whole blood 4.80E-02 1.51E-01 5.94E-01
Cervical cancer 2C77 Cervical tissue 2.53E-03 -1.59E-01 -5.18E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.07E-01 1.17E-02 2.71E-02
Chronic hepatitis C 1E51.1 Whole blood 4.11E-01 -8.17E-02 -6.31E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.21E-01 -4.31E-02 -4.10E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.55E-01 5.79E-02 3.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.96E-01 8.45E-02 7.70E-01
Colon cancer 2B90 Colon tissue 2.68E-32 -2.21E-01 -1.18E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.09E-01 1.96E-01 1.19E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.62E-01 -5.89E-02 -5.52E-01
Endometriosis GA10 Endometrium tissue 1.40E-01 4.67E-02 2.42E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.49E-01 4.92E-02 5.54E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.77E-01 3.03E-03 1.91E-02
Gastric cancer 2B72 Gastric tissue 4.38E-01 3.68E-02 1.84E-01
Glioblastopma 2A00.00 Nervous tissue 2.26E-02 4.26E-02 1.96E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.55E-02 -2.22E-01 -3.34E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.30E-02 -3.00E-01 -9.72E-01
Head and neck cancer 2D42 Head and neck tissue 1.93E-21 -3.36E-01 -1.26E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.47E-02 2.47E-01 1.16E+00
Huntington's disease 8A01.10 Whole blood 3.14E-01 -4.52E-02 -3.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.71E-02 -2.17E-01 -1.57E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.18E-01 7.65E-03 7.00E-02
Influenza 1E30 Whole blood 4.65E-01 -7.33E-02 -1.23E+00
Interstitial cystitis GC00.3 Bladder tissue 1.81E-01 -5.18E-02 -3.87E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.04E-01 -3.77E-01 -1.07E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.92E-01 -3.48E-02 -2.01E-01
Ischemic stroke 8B11 Peripheral blood 9.10E-01 1.52E-02 8.60E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.23E-01 1.01E-02 4.05E-02
Lateral sclerosis 8B60.4 Skin 5.68E-01 -1.39E-02 -1.96E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.07E-02 3.12E-01 1.27E+00
Liver cancer 2C12.0 Liver tissue 2.16E-02 7.51E-02 5.20E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.05E-03 2.01E-01 2.07E+00
Lung cancer 2C25 Lung tissue 1.00E-05 -5.16E-02 -2.88E-01
Lupus erythematosus 4A40 Whole blood 6.85E-08 1.23E-01 3.29E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.82E-01 1.04E-02 8.47E-02
Major depressive disorder 6A70-6A7Z Whole blood 7.22E-01 4.35E-02 2.25E-01
Melanoma 2C30 Skin 5.16E-03 -1.26E-01 -4.15E-01
Multiple myeloma 2A83.1 Peripheral blood 1.33E-01 -5.29E-02 -6.12E-01
Multiple myeloma 2A83.1 Bone marrow 1.08E-01 7.61E-02 5.67E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.19E-01 -8.64E-02 -4.65E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.99E-06 -1.08E-01 -7.61E-01
Myelofibrosis 2A20.2 Whole blood 2.94E-01 -8.34E-02 -8.05E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.18E-01 8.15E-02 2.27E-01
Myopathy 8C70.6 Muscle tissue 6.42E-02 -2.26E-01 -1.38E+00
Neonatal sepsis KA60 Whole blood 7.56E-07 1.96E-01 7.88E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.53E-01 1.34E-01 6.08E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.79E-02 2.06E-01 9.76E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.80E-01 -4.98E-02 -3.33E-01
Olive pollen allergy CA08.00 Peripheral blood 7.99E-01 -2.20E-02 -1.11E-01
Oral cancer 2B6E Oral tissue 7.20E-03 -1.33E-01 -5.18E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.91E-01 -2.04E-02 -6.41E-02
Osteoporosis FB83.1 Bone marrow 3.02E-03 -1.91E-01 -3.41E+00
Ovarian cancer 2C73 Ovarian tissue 5.46E-01 3.44E-02 1.17E-01
Pancreatic cancer 2C10 Pancreas 2.88E-02 1.60E-01 8.40E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.07E-01 4.62E-02 2.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.92E-03 1.38E-01 1.43E+00
Pituitary cancer 2D12 Pituitary tissue 2.76E-01 -1.37E-02 -1.18E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.32E-01 -5.73E-02 -5.68E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.06E-01 3.76E-02 2.46E-01
Polycythemia vera 2A20.4 Whole blood 1.78E-09 1.65E-01 1.51E+00
Pompe disease 5C51.3 Biceps muscle 3.77E-09 -8.65E-01 -4.57E+00
Preterm birth KA21.4Z Myometrium 4.28E-01 -4.25E-02 -3.32E-01
Prostate cancer 2C82 Prostate 2.46E-02 1.39E-01 5.79E-01
Psoriasis EA90 Skin 4.76E-06 1.36E-01 6.98E-01
Rectal cancer 2B92 Rectal colon tissue 2.17E-01 -1.14E-01 -1.11E+00
Renal cancer 2C90-2C91 Kidney 7.20E-01 -5.86E-02 -2.83E-01
Retinoblastoma 2D02.2 Uvea 1.04E-01 -5.43E-02 -6.06E-01
Rheumatoid arthritis FA20 Synovial tissue 6.81E-01 -9.00E-02 -3.60E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.11E-02 3.32E-02 3.03E-01
Schizophrenia 6A20 Prefrontal cortex 4.74E-02 1.37E-01 5.40E-01
Schizophrenia 6A20 Superior temporal cortex 4.36E-01 6.84E-02 5.64E-01
Scleroderma 4A42.Z Whole blood 4.62E-01 1.93E-02 2.51E-01
Seizure 8A60-8A6Z Whole blood 7.78E-01 -7.67E-03 -2.55E-02
Sensitive skin EK0Z Skin 7.37E-01 4.82E-02 4.04E-01
Sepsis with septic shock 1G41 Whole blood 3.41E-10 1.97E-01 7.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.77E-02 -3.30E-01 -1.07E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.72E-03 3.20E-01 1.41E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.15E-01 -1.55E-01 -1.49E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.01E-02 -3.41E-02 -7.73E-01
Skin cancer 2C30-2C3Z Skin 3.90E-05 -7.23E-02 -3.86E-01
Thrombocythemia 3B63 Whole blood 1.67E-04 7.53E-02 7.30E-01
Thrombocytopenia 3B64 Whole blood 2.37E-01 -3.58E-01 -6.17E-01
Thyroid cancer 2D10 Thyroid 2.08E-17 -2.47E-01 -1.25E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.67E-02 -2.48E-01 -1.03E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.06E-01 1.81E-01 3.52E+00
Type 2 diabetes 5A11 Liver tissue 9.04E-01 -3.99E-02 -3.13E-01
Ureter cancer 2C92 Urothelium 9.00E-01 1.41E-01 2.53E-01
Uterine cancer 2C78 Endometrium tissue 3.72E-04 1.34E-01 4.11E-01
Vitiligo ED63.0 Skin 4.01E-01 -5.10E-02 -3.83E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Phosphorylation of ribavirin and viramidine by adenosine kinase and cytosolic 5'-nucleotidase II: Implications for ribavirin metabolism in erythrocytes. Antimicrob Agents Chemother. 2005 Jun;49(6):2164-71.