Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE1ZNSC)

DME Name	Heparanase (HPSE)
Synonyms	Endo-glucoronidase; Heparanase 50 kDa subunit; Heparanase 8 kDa subunit; Heparanase-1; HEP; HPA; HPA1; Hpa1; HPR1; HPSE; HPSE1; HSE1
Gene Name	HPSE
UniProt ID	HPSE_HUMAN
INTEDE ID	DME0113
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	10855
EC Number	EC: 3.2.1.166 Hydrolases Glycosylase O/S-glycosyl compound glycosidase EC: 3.2.1.166
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA ACI
Function	This enzyme cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. It selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. It can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety.
KEGG Pathway	Glycosaminoglycan degradation (hsa00531 ) Metabolic pathways (hsa01100 ) Proteoglycans in cancer (hsa05205 )
Reactome Pathway	Neutrophil degranulation (R-HSA-6798695 ) HS-GAG degradation (R-HSA-2024096 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.38E-09	-6.83E-01	-8.14E-01
Alopecia	ED70	Skin from scalp	6.46E-02	2.51E-01	3.23E-01
Alzheimer's disease	8A20	Entorhinal cortex	2.56E-06	2.41E-01	8.27E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	4.69E-01	4.91E-02	1.02E-01
Aortic stenosis	BB70	Calcified aortic valve	9.56E-02	7.82E-01	1.43E+00
Apnea	7A40	Hyperplastic tonsil	2.68E-01	-6.77E-01	-1.26E+00
Arthropathy	FA00-FA5Z	Peripheral blood	1.45E-02	3.06E-01	7.81E-01
Asthma	CA23	Nasal and bronchial airway	5.99E-07	7.73E-01	5.96E-01
Atopic dermatitis	EA80	Skin	4.53E-01	-4.21E-01	-1.56E+00
Autism	6A02	Whole blood	3.83E-01	4.48E-02	8.94E-02
Autoimmune uveitis	9A96	Peripheral monocyte	6.30E-02	4.17E-01	2.69E-01
Autosomal dominant monocytopenia	4B04	Whole blood	6.15E-02	1.59E+00	2.88E+00
Bacterial infection of gingival	1C1H	Gingival tissue	8.54E-16	-5.54E-01	-1.54E+00
Batten disease	5C56.1	Whole blood	7.55E-01	1.14E-01	2.02E-01
Behcet's disease	4A62	Peripheral blood	9.34E-01	-1.59E-01	-3.35E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	1.30E-01	-9.21E-02	-4.80E-01
Bladder cancer	2C94	Bladder tissue	8.72E-06	2.97E-01	1.32E+00
Breast cancer	2C60-2C6Z	Breast tissue	6.31E-57	5.71E-01	1.24E+00
Cardioembolic stroke	8B11.20	Whole blood	1.08E-07	5.76E-01	1.44E+00
Cervical cancer	2C77	Cervical tissue	5.72E-01	-2.27E-01	-4.01E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	5.07E-01	2.40E-01	2.73E-01
Chronic hepatitis C	1E51.1	Whole blood	7.69E-01	-3.37E-01	-3.23E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	1.51E-01	-5.44E-02	-1.28E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.06E-02	-1.56E-01	-3.38E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.11E-01	1.44E-01	4.35E-01
Colon cancer	2B90	Colon tissue	8.18E-47	-7.15E-01	-1.75E+00
Coronary artery disease	BA80-BA8Z	Peripheral blood	7.42E-01	1.06E-01	2.00E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	7.94E-01	-1.21E-01	-1.79E-01
Endometriosis	GA10	Endometrium tissue	9.03E-04	6.22E-01	9.63E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	7.15E-01	2.05E-01	8.26E-01
Familial hypercholesterolemia	5C80.00	Whole blood	5.24E-16	1.17E+00	1.78E+00
Gastric cancer	2B72	Gastric tissue	5.02E-02	1.77E+00	2.53E+00
Glioblastopma	2A00.00	Nervous tissue	2.78E-89	6.30E-01	1.54E+00
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	1.68E-01	-9.52E-01	-2.22E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	8.03E-02	5.49E-01	3.71E-01
Head and neck cancer	2D42	Head and neck tissue	5.19E-02	2.38E-01	2.78E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	2.54E-01	7.72E-02	3.31E-01
Huntington's disease	8A01.10	Whole blood	7.38E-01	-3.09E-01	-3.93E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	4.14E-01	-2.02E-01	-5.02E-01
Immunodeficiency	4A00-4A20	Peripheral blood	2.64E-04	4.70E-01	1.94E+00
Influenza	1E30	Whole blood	9.91E-01	4.44E-01	4.94E-01
Interstitial cystitis	GC00.3	Bladder tissue	3.14E-06	1.02E+00	7.62E+00
Intracranial aneurysm	8B01.0	Intracranial artery	4.73E-02	6.88E-01	2.06E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	6.86E-01	-1.02E-02	-2.68E-02
Ischemic stroke	8B11	Peripheral blood	8.27E-01	1.94E-01	5.14E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	8.12E-05	2.90E-01	4.92E-01
Lateral sclerosis	8B60.4	Skin	5.05E-01	1.70E-01	3.05E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	3.78E-03	4.20E-01	2.08E+00
Liver cancer	2C12.0	Liver tissue	1.18E-01	-1.85E-01	-3.04E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.41E-04	1.74E+00	2.54E+00
Lung cancer	2C25	Lung tissue	1.42E-47	8.66E-01	1.62E+00
Lupus erythematosus	4A40	Whole blood	5.11E-01	1.98E-01	1.55E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	8.08E-01	-2.21E-02	-1.27E-01
Major depressive disorder	6A70-6A7Z	Whole blood	8.77E-02	2.17E-01	5.45E-01
Melanoma	2C30	Skin	7.77E-04	1.02E+00	8.87E-01
Multiple myeloma	2A83.1	Peripheral blood	5.03E-01	6.16E-02	6.75E-02
Multiple myeloma	2A83.1	Bone marrow	2.21E-02	2.38E-01	6.42E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	1.39E-01	3.92E-01	6.05E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	6.63E-08	4.32E-01	9.25E-01
Myelofibrosis	2A20.2	Whole blood	7.18E-03	8.89E-01	2.80E+00
Myocardial infarction	BA41-BA50	Peripheral blood	2.30E-02	8.15E-01	8.37E-01
Myopathy	8C70.6	Muscle tissue	2.21E-05	4.81E-01	5.63E+00
Neonatal sepsis	KA60	Whole blood	1.32E-21	1.06E+00	1.45E+00
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.45E-01	-2.30E-01	-5.87E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	3.45E-02	4.41E-01	2.05E+00
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.15E-02	-5.45E-01	-1.03E+00
Olive pollen allergy	CA08.00	Peripheral blood	3.34E-02	-6.95E-01	-1.20E+00
Oral cancer	2B6E	Oral tissue	9.48E-01	-2.46E-01	-2.13E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	1.22E-02	8.41E-01	1.29E+00
Osteoporosis	FB83.1	Bone marrow	4.63E-01	7.48E-02	1.19E-01
Ovarian cancer	2C73	Ovarian tissue	2.20E-03	6.75E-01	1.42E+00
Pancreatic cancer	2C10	Pancreas	3.04E-05	8.04E-01	1.53E+00
Parkinson's disease	8A00.0	Substantia nigra tissue	5.08E-01	-2.90E-02	-1.09E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	1.02E-05	1.25E+00	1.44E+00
Pituitary cancer	2D12	Pituitary tissue	4.42E-01	9.77E-02	2.19E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	6.51E-01	2.38E-01	5.11E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.85E-01	5.57E-02	3.12E-01
Polycythemia vera	2A20.4	Whole blood	2.01E-14	7.96E-01	2.31E+00
Pompe disease	5C51.3	Biceps muscle	1.13E-02	3.85E-01	2.42E+00
Preterm birth	KA21.4Z	Myometrium	2.93E-01	-8.00E-01	-1.05E+00
Prostate cancer	2C82	Prostate	8.10E-01	1.89E-01	2.26E-01
Psoriasis	EA90	Skin	9.55E-64	2.83E+00	5.16E+00
Rectal cancer	2B92	Rectal colon tissue	4.68E-05	-1.08E+00	-3.83E+00
Renal cancer	2C90-2C91	Kidney	8.04E-07	9.28E-01	2.43E+00
Retinoblastoma	2D02.2	Uvea	1.82E-04	1.74E+00	2.98E+01
Rheumatoid arthritis	FA20	Synovial tissue	3.54E-02	5.10E-01	8.01E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.11E-01	1.31E-01	2.69E-01
Schizophrenia	6A20	Prefrontal cortex	8.01E-02	7.01E-02	4.25E-02
Schizophrenia	6A20	Superior temporal cortex	8.62E-01	-5.05E-02	-3.93E-01
Scleroderma	4A42.Z	Whole blood	7.77E-03	2.20E-01	8.13E-01
Seizure	8A60-8A6Z	Whole blood	7.06E-01	-1.34E-01	-1.45E-01
Sensitive skin	EK0Z	Skin	3.05E-01	3.44E-01	9.11E-01
Sepsis with septic shock	1G41	Whole blood	8.58E-56	1.33E+00	1.85E+00
Shwachman-Diamond syndrome	3A70.0	Bone marrow	7.07E-01	-1.01E-01	-4.22E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	2.68E-06	2.48E+00	3.78E+00
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.16E-01	1.11E-01	5.56E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	2.15E-01	-4.35E-01	-1.18E+00
Skin cancer	2C30-2C3Z	Skin	1.19E-02	1.47E-01	2.34E-01
Thrombocythemia	3B63	Whole blood	2.07E-02	3.83E-01	1.20E+00
Thrombocytopenia	3B64	Whole blood	4.91E-02	-4.93E-01	-6.42E-01
Thyroid cancer	2D10	Thyroid	1.12E-22	8.07E-01	1.39E+00
Tibial muscular dystrophy	8C75	Muscle tissue	3.94E-05	5.26E-01	2.17E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.16E-01	5.60E-01	3.90E+00
Type 2 diabetes	5A11	Liver tissue	3.86E-01	4.25E-02	1.38E-01
Ureter cancer	2C92	Urothelium	8.90E-01	4.33E-02	9.29E-02
Uterine cancer	2C78	Endometrium tissue	4.23E-02	5.24E-01	4.40E-01
Vitiligo	ED63.0	Skin	9.76E-01	-1.82E-01	-3.19E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Heparanase (HPSE) DTT Info

DME DTT Type

Successful

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PG-545	DM68D3O	Ocular disease	1F00.1Z	Phase 1	[1]
Suramin	DMTOUY9	African trypanosomiasis	1F51	Phase 1	[2]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Neutralase	DMXHWK6	Angiogenesis disorder	BE2Z	Discontinued in Phase 3	[3]
------------------------------------------------------------------------------------

References

1	PG545, a dual heparanase and angiogenesis inhibitor, induces potent anti-tumour and anti-metastatic efficacy in preclinical models. Br J Cancer. 2011 Feb 15;104(4):635-42.
2	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1728).
3	Heparanase neutralizes the anticoagulation properties of heparin and low-molecular-weight heparin. J Thromb Haemost. 2006 Mar;4(3):560-5.