Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE20ETR)

DME Name Uracil phosphoribosyltransferase (UPRT)
Synonyms Uracil phospho-ribosyl-transferase; Uracil phosphoribosyltransferase homolog; UPRT
Gene Name UPRT
UniProt ID
UPP_HUMAN
INTEDE ID
DME0428
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
139596
EC Number EC: 2.4.2.9
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSL
PAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIR
ELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNC
GVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPI
LSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTH
FGQKYFGTD
Function This enzyme is an enzyme which creates UMP from uracil and phosphoribosylpyrophosphate.
KEGG Pathway
( )
( )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fluorouracil DMUM7HZ Solid tumour/cancer 2A00-2F9Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.70E-02 1.01E-01 2.45E-01
Alopecia ED70 Skin from scalp 3.45E-02 1.31E-01 4.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.99E-06 -2.84E-01 -8.44E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.16E-01 9.71E-02 3.70E-01
Aortic stenosis BB70 Calcified aortic valve 7.47E-01 1.89E-01 1.66E-01
Apnea 7A40 Hyperplastic tonsil 3.08E-01 3.48E-01 6.19E-01
Arthropathy FA00-FA5Z Peripheral blood 1.72E-01 -1.28E-01 -5.66E-01
Asthma CA23 Nasal and bronchial airway 1.07E-09 8.18E-01 9.23E-01
Atopic dermatitis EA80 Skin 4.61E-03 -7.00E-02 -5.84E-01
Autism 6A02 Whole blood 4.29E-01 1.98E-01 3.55E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.56E-01 -1.98E-01 -8.36E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.47E-03 1.05E+00 1.93E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.85E-01 5.56E-02 1.67E-01
Batten disease 5C56.1 Whole blood 1.11E-01 -3.09E-01 -1.15E+00
Behcet's disease 4A62 Peripheral blood 8.26E-01 3.46E-02 1.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.76E-01 7.71E-02 3.31E-01
Bladder cancer 2C94 Bladder tissue 3.11E-08 -7.60E-01 -4.08E+00
Breast cancer 2C60-2C6Z Breast tissue 7.28E-13 3.75E-01 5.62E-01
Cardioembolic stroke 8B11.20 Whole blood 2.36E-02 -1.34E-01 -5.84E-01
Cervical cancer 2C77 Cervical tissue 3.87E-07 -3.37E-01 -1.35E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.32E-01 1.01E-01 7.71E-02
Chronic hepatitis C 1E51.1 Whole blood 7.35E-01 -4.52E-02 -2.55E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.98E-01 -7.30E-02 -2.46E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.35E-07 -3.51E-01 -8.75E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.27E-02 -3.64E-01 -1.18E+00
Colon cancer 2B90 Colon tissue 2.71E-02 7.79E-02 2.13E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.39E-01 9.21E-02 1.89E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.91E-01 -1.71E-01 -2.21E-01
Endometriosis GA10 Endometrium tissue 2.52E-01 -1.90E-01 -2.69E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.62E-02 1.92E-01 7.41E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.32E-09 1.05E+00 1.65E+00
Gastric cancer 2B72 Gastric tissue 8.76E-01 -5.29E-01 -5.60E-01
Glioblastopma 2A00.00 Nervous tissue 1.24E-39 3.97E-01 7.29E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.12E-01 -1.83E-02 -1.68E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.27E-01 -1.03E-01 -1.59E-01
Head and neck cancer 2D42 Head and neck tissue 3.64E-30 -9.65E-01 -1.45E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.37E-01 -1.53E-01 -3.88E-01
Huntington's disease 8A01.10 Whole blood 1.51E-01 -1.60E-01 -5.29E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.35E-03 -3.25E-01 -3.13E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.08E-02 -3.37E-01 -9.62E-01
Influenza 1E30 Whole blood 1.65E-04 -1.67E+00 -8.18E+00
Interstitial cystitis GC00.3 Bladder tissue 2.95E-01 -8.37E-02 -4.68E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.29E-02 3.71E-01 1.07E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.74E-01 7.89E-02 2.26E-01
Ischemic stroke 8B11 Peripheral blood 9.45E-01 -6.39E-02 -3.07E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.43E-01 1.09E-01 1.07E-01
Lateral sclerosis 8B60.4 Skin 3.29E-01 -2.27E-02 -1.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.50E-01 -9.09E-02 -1.31E-01
Liver cancer 2C12.0 Liver tissue 5.34E-03 3.40E-01 5.62E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.26E-03 -6.72E-01 -1.46E+00
Lung cancer 2C25 Lung tissue 5.30E-11 -2.22E-01 -7.78E-01
Lupus erythematosus 4A40 Whole blood 7.89E-02 3.28E-01 2.70E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.94E-01 1.76E-02 8.71E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.07E-01 4.92E-02 1.39E-01
Melanoma 2C30 Skin 6.49E-01 2.09E-02 2.93E-02
Multiple myeloma 2A83.1 Peripheral blood 5.57E-01 -3.15E-03 -9.62E-03
Multiple myeloma 2A83.1 Bone marrow 5.82E-06 9.04E-01 3.80E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.53E-01 -3.89E-01 -8.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.30E-01 -9.58E-02 -2.37E-01
Myelofibrosis 2A20.2 Whole blood 9.40E-03 -2.15E-01 -1.08E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.61E-01 -2.97E-01 -3.09E-01
Myopathy 8C70.6 Muscle tissue 6.27E-01 9.63E-02 2.42E-01
Neonatal sepsis KA60 Whole blood 3.22E-01 -2.19E-01 -3.25E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.47E-05 1.59E+00 2.88E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.68E-02 3.87E-01 1.84E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.03E-03 -3.13E-01 -2.88E+00
Olive pollen allergy CA08.00 Peripheral blood 5.10E-01 4.67E-01 7.67E-01
Oral cancer 2B6E Oral tissue 3.52E-01 4.01E-01 6.86E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.82E-01 1.68E-01 5.87E-01
Osteoporosis FB83.1 Bone marrow 2.58E-02 -4.14E-01 -1.95E+00
Ovarian cancer 2C73 Ovarian tissue 7.29E-03 4.64E-01 1.19E+00
Pancreatic cancer 2C10 Pancreas 1.10E-03 4.81E-01 1.24E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.36E-01 -6.48E-01 -8.43E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.21E-01 -7.06E-02 -4.81E-01
Pituitary cancer 2D12 Pituitary tissue 3.45E-03 3.36E-01 6.61E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.93E-04 4.83E-01 1.61E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.07E-01 -1.05E-01 -4.97E-01
Polycythemia vera 2A20.4 Whole blood 4.32E-14 -3.33E-01 -1.59E+00
Pompe disease 5C51.3 Biceps muscle 1.95E-03 -2.85E-01 -3.12E+00
Preterm birth KA21.4Z Myometrium 2.27E-01 3.20E-01 4.82E-01
Prostate cancer 2C82 Prostate 1.83E-05 1.27E+00 1.80E+00
Psoriasis EA90 Skin 8.20E-02 -1.42E-02 -3.15E-02
Rectal cancer 2B92 Rectal colon tissue 3.85E-06 -3.58E-01 -3.38E+00
Renal cancer 2C90-2C91 Kidney 8.04E-03 6.29E-01 1.26E+00
Retinoblastoma 2D02.2 Uvea 5.17E-04 7.86E-01 3.74E+00
Rheumatoid arthritis FA20 Synovial tissue 1.68E-02 -4.42E-01 -1.44E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.49E-01 6.25E-02 2.86E-01
Schizophrenia 6A20 Prefrontal cortex 5.14E-01 -5.47E-02 -8.99E-02
Schizophrenia 6A20 Superior temporal cortex 3.49E-01 1.10E-01 4.75E-01
Scleroderma 4A42.Z Whole blood 4.02E-03 -2.27E-01 -1.24E+00
Seizure 8A60-8A6Z Whole blood 6.02E-01 1.55E-01 4.17E-01
Sensitive skin EK0Z Skin 9.57E-01 -2.11E-02 -1.29E-01
Sepsis with septic shock 1G41 Whole blood 5.59E-36 -6.66E-01 -1.26E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.24E-02 -5.11E-01 -1.54E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.51E-01 -1.64E-02 -3.95E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 4.40E-01 2.12E-02 1.82E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.00E-01 1.85E-01 6.97E-01
Skin cancer 2C30-2C3Z Skin 2.57E-05 9.34E-02 1.93E-01
Thrombocythemia 3B63 Whole blood 1.39E-05 -2.39E-01 -1.22E+00
Thrombocytopenia 3B64 Whole blood 2.78E-01 -6.24E-01 -8.46E-01
Thyroid cancer 2D10 Thyroid 5.53E-08 -2.61E-01 -1.19E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.27E-01 4.06E-02 1.32E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.86E-03 -5.72E-01 -4.01E+00
Type 2 diabetes 5A11 Liver tissue 2.12E-01 1.83E-01 6.24E-01
Ureter cancer 2C92 Urothelium 2.09E-01 -9.88E-02 -2.35E-01
Uterine cancer 2C78 Endometrium tissue 2.42E-02 -7.62E-03 -1.40E-02
Vitiligo ED63.0 Skin 7.55E-05 5.63E-01 3.03E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Combined suicide gene therapy for human colon cancer cells using adenovirus-mediated transfer of escherichia coli cytosine deaminase gene and Escherichia coli uracil phosphoribosyltransferase gene with 5-fluorocytosine. Cancer Gene Ther. 2000 Jul;7(7):1015-22.