Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE2JP1Y)

DME Name Aldehyde dehydrogenase 1 (ALDH1)
Synonyms Aldehyde dehydrogenase 1 family member A1; Cytosolic aldehyde dehydrogenase; ALDC; ALDH-E1; ALDH1; ALDH1A1; ALHDII; PUMB1; RALDH 1; RalDH1; Retinal dehydrogenase 1
Gene Name ALDH1A1
UniProt ID
AL1A1_HUMAN
INTEDE ID
DME0286
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
216
EC Number EC: 1.2.1.36
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.36
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Function This enzyme can convert/oxidize retinaldehyde to retinoic acid and it may have a broader specificity and oxidize other aldehydes in vivo.
KEGG Pathway
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Reactome Pathway
Fructose catabolism (R-HSA-70350 )
RA biosynthesis pathway (R-HSA-5365859 )
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
all-trans-retinal DM6CEVB Discovery agent N.A. Investigative [1]
Decanal DMWZKLM N. A. N. A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
all-trans-retinal Discovery agent [N.A.] Investigative Km = 0.0081 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.29E-41 -1.95E+00 -2.76E+00
Alopecia ED70 Skin from scalp 2.70E-02 2.37E-01 4.16E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.91E-01 -1.12E-01 -1.37E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.53E-01 3.02E-02 4.50E-02
Aortic stenosis BB70 Calcified aortic valve 3.51E-02 -1.31E+00 -1.08E+00
Apnea 7A40 Hyperplastic tonsil 2.27E-01 1.18E+00 2.81E+00
Arthropathy FA00-FA5Z Peripheral blood 8.01E-01 -7.01E-02 -2.17E-01
Asthma CA23 Nasal and bronchial airway 9.11E-01 -1.75E-02 -4.27E-02
Atopic dermatitis EA80 Skin 8.52E-11 -1.27E+00 -2.23E+00
Autism 6A02 Whole blood 1.53E-01 1.34E-01 2.33E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.31E-01 1.92E-01 9.72E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.27E-01 -1.38E-01 -2.86E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.87E-02 7.74E-01 6.85E-01
Batten disease 5C56.1 Whole blood 4.12E-01 -1.60E-01 -3.44E-01
Behcet's disease 4A62 Peripheral blood 5.12E-01 2.61E-01 5.39E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.09E-01 -8.44E-02 -2.40E-01
Bladder cancer 2C94 Bladder tissue 1.57E-20 -3.88E+00 -1.28E+01
Breast cancer 2C60-2C6Z Breast tissue 1.36E-79 -2.87E+00 -1.90E+00
Cardioembolic stroke 8B11.20 Whole blood 1.83E-01 -9.69E-02 -1.79E-01
Cervical cancer 2C77 Cervical tissue 6.60E-01 -3.40E-01 -2.64E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.07E-01 -1.93E-02 -1.17E-02
Chronic hepatitis C 1E51.1 Whole blood 7.00E-01 -8.72E-01 -5.10E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.14E-01 -9.64E-02 -2.24E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.30E-02 -8.54E-02 -2.82E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.07E-02 -1.24E+00 -1.78E+00
Colon cancer 2B90 Colon tissue 1.73E-76 -1.60E+00 -2.63E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.81E-03 4.93E-01 2.32E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.94E-01 -9.50E-02 -5.55E-01
Endometriosis GA10 Endometrium tissue 6.20E-01 -6.06E-01 -2.44E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.86E-02 -1.32E-01 -1.68E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.49E-04 2.38E+00 1.75E+00
Gastric cancer 2B72 Gastric tissue 1.34E-01 -1.77E+00 -1.39E+00
Glioblastopma 2A00.00 Nervous tissue 3.45E-61 -1.72E+00 -1.32E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.01E-01 -2.85E+00 -1.60E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.43E-01 -5.13E-01 -4.47E-01
Head and neck cancer 2D42 Head and neck tissue 2.73E-35 -4.23E+00 -2.14E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.13E-02 -3.39E-01 -7.65E-01
Huntington's disease 8A01.10 Whole blood 6.42E-01 -4.02E-01 -4.83E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.77E-01 -2.24E-01 -2.74E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.35E-01 2.66E-02 3.32E-01
Influenza 1E30 Whole blood 8.22E-01 1.65E-01 3.71E-01
Interstitial cystitis GC00.3 Bladder tissue 1.54E-03 -9.51E-01 -2.90E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.39E-03 -1.09E+00 -1.14E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.24E-02 -1.06E-01 -3.82E-01
Ischemic stroke 8B11 Peripheral blood 2.16E-01 -1.64E-01 -3.08E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.04E-09 -5.83E-01 -7.74E-01
Lateral sclerosis 8B60.4 Skin 3.86E-01 -4.53E-02 -1.52E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.42E-01 -2.40E-01 -7.51E-01
Liver cancer 2C12.0 Liver tissue 6.92E-01 1.79E-02 1.95E-02
Liver failure DB99.7-DB99.8 Liver tissue 7.76E-01 5.55E-01 7.57E-01
Lung cancer 2C25 Lung tissue 1.32E-86 -1.48E+00 -2.67E+00
Lupus erythematosus 4A40 Whole blood 2.24E-03 8.89E-01 5.91E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.42E-01 -1.13E-01 -3.27E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.53E-01 -2.11E-02 -4.30E-02
Melanoma 2C30 Skin 2.29E-01 -2.61E-02 -1.54E-02
Multiple myeloma 2A83.1 Peripheral blood 4.04E-01 4.26E-02 1.28E-01
Multiple myeloma 2A83.1 Bone marrow 6.75E-03 -1.25E+00 -1.29E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.83E-02 4.26E-01 6.92E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.13E-03 -2.31E-01 -3.62E-01
Myelofibrosis 2A20.2 Whole blood 7.97E-02 -2.22E-01 -4.17E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.87E-04 7.31E-01 6.74E-01
Myopathy 8C70.6 Muscle tissue 8.64E-02 4.27E-01 7.20E-01
Neonatal sepsis KA60 Whole blood 5.17E-06 -8.01E-01 -1.19E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.81E-09 -4.90E+00 -5.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.68E-01 2.79E-01 7.58E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.67E-01 -1.11E-01 -2.27E-01
Olive pollen allergy CA08.00 Peripheral blood 5.77E-02 3.33E-01 1.16E+00
Oral cancer 2B6E Oral tissue 2.70E-01 -4.27E-01 -2.05E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.41E-01 -1.45E+00 -7.36E-01
Osteoporosis FB83.1 Bone marrow 9.19E-01 -9.71E-03 -7.21E-02
Ovarian cancer 2C73 Ovarian tissue 1.12E-05 -3.34E+00 -3.66E+00
Pancreatic cancer 2C10 Pancreas 5.26E-01 2.64E-01 2.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.84E-03 -1.20E+00 -8.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.50E-02 -4.65E-01 -4.39E-01
Pituitary cancer 2D12 Pituitary tissue 5.74E-08 -2.66E+00 -7.30E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.08E-04 -2.03E+00 -5.09E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.50E-01 -1.31E-01 -3.27E-01
Polycythemia vera 2A20.4 Whole blood 3.66E-04 -2.55E-01 -5.07E-01
Pompe disease 5C51.3 Biceps muscle 2.57E-01 -2.56E-01 -1.12E+00
Preterm birth KA21.4Z Myometrium 4.89E-01 1.75E-01 1.17E-01
Prostate cancer 2C82 Prostate 9.39E-01 3.56E-01 3.91E-01
Psoriasis EA90 Skin 5.09E-06 -4.25E-01 -5.23E-01
Rectal cancer 2B92 Rectal colon tissue 8.07E-07 -1.32E+00 -3.76E+00
Renal cancer 2C90-2C91 Kidney 1.12E-02 9.46E-03 1.76E-02
Retinoblastoma 2D02.2 Uvea 1.21E-05 3.37E+00 2.47E+01
Rheumatoid arthritis FA20 Synovial tissue 2.88E-01 2.25E-01 2.01E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.81E-02 -8.20E-02 -5.18E-01
Schizophrenia 6A20 Prefrontal cortex 1.45E-01 5.01E-03 9.65E-03
Schizophrenia 6A20 Superior temporal cortex 1.74E-02 -3.32E-01 -8.91E-01
Scleroderma 4A42.Z Whole blood 6.10E-01 7.17E-02 1.56E-01
Seizure 8A60-8A6Z Whole blood 7.56E-01 4.55E-02 6.23E-02
Sensitive skin EK0Z Skin 3.51E-01 3.36E-01 1.18E+00
Sepsis with septic shock 1G41 Whole blood 5.72E-45 -1.33E+00 -1.84E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.02E-03 -1.17E+00 -2.21E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.69E-01 -8.26E-02 -3.09E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.70E-01 4.32E-02 1.19E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.58E-01 -4.18E-02 -4.08E-01
Skin cancer 2C30-2C3Z Skin 2.83E-04 -5.70E-01 -6.58E-01
Thrombocythemia 3B63 Whole blood 2.25E-04 -2.51E-01 -4.82E-01
Thrombocytopenia 3B64 Whole blood 5.23E-01 1.20E+00 8.88E-01
Thyroid cancer 2D10 Thyroid 1.86E-42 -1.60E+00 -2.64E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.44E-01 1.19E-01 2.37E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.81E-01 -2.59E-01 -6.54E-01
Type 2 diabetes 5A11 Liver tissue 3.45E-01 -1.94E-02 -1.40E-01
Ureter cancer 2C92 Urothelium 7.37E-01 9.61E-03 4.56E-02
Uterine cancer 2C78 Endometrium tissue 9.66E-29 -2.62E+00 -1.60E+00
Vitiligo ED63.0 Skin 6.76E-01 3.63E-01 8.33E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Retinoic acid biosynthesis catalyzed by retinal dehydrogenases relies on a rate-limiting conformational transition associated with substrate recognition. Chem Biol Interact. 2013 Feb 25;202(1-3):78-84.