Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3E0VT)

DME Name L-glutamine amidohydrolase (GLS)
Synonyms K-glutaminase; Mitochondrial glutaminase kidney isoform; Mitochondrial 65 kDa glutaminase kidney isoform; Mitochondrial 68 kDa glutaminase kidney isoform; GLS; GLS1; KIAA0838
Gene Name GLS
UniProt ID
GLSK_HUMAN
INTEDE ID
DME0126
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2744
EC Number EC: 3.5.1.2
Hydrolases
Carbon-nitrogen hydrolase
Linear amide hydrolase
EC: 3.5.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
Function This enzyme catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine.
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Arginine biosynthesis (hsa00220 )
Central carbon metabolism in cancer (hsa05230 )
D-Glutamine and D-glutamate metabolism (hsa00471 )
GABAergic synapse (hsa04727 )
Glutamatergic synapse (hsa04724 )
Metabolic pathways (hsa01100 )
MicroRNAs in cancer (hsa05206 )
Proximal tubule bicarbonate reclamation (hsa04964 )
Reactome Pathway
Glutamate and glutamine metabolism (R-HSA-8964539 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )
Glutamate Neurotransmitter Release Cycle (R-HSA-210500 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Esculin DMANEC9 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.10E-03 -1.83E-01 -6.50E-01
Alopecia ED70 Skin from scalp 2.69E-04 2.73E-01 1.10E+00
Alzheimer's disease 8A20 Entorhinal cortex 4.44E-08 1.47E-01 7.29E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.65E-01 -1.56E-01 -3.80E-01
Aortic stenosis BB70 Calcified aortic valve 1.80E-01 7.57E-03 2.68E-02
Apnea 7A40 Hyperplastic tonsil 7.45E-01 -4.36E-02 -2.18E-01
Arthropathy FA00-FA5Z Peripheral blood 9.40E-01 1.12E-01 2.67E-01
Asthma CA23 Nasal and bronchial airway 1.23E-01 -6.62E-02 -1.06E-01
Atopic dermatitis EA80 Skin 5.20E-03 1.98E-01 7.96E-01
Autism 6A02 Whole blood 8.66E-01 -8.25E-02 -2.15E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.91E-03 9.77E-01 6.01E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.88E-01 9.52E-02 5.45E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.80E-08 2.54E-01 8.05E-01
Batten disease 5C56.1 Whole blood 3.08E-01 -1.72E-01 -7.69E-01
Behcet's disease 4A62 Peripheral blood 4.46E-01 -6.40E-02 -2.61E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.50E-01 -2.39E-02 -1.50E-01
Bladder cancer 2C94 Bladder tissue 9.36E-01 -9.38E-02 -3.99E-01
Breast cancer 2C60-2C6Z Breast tissue 1.12E-11 2.88E-01 6.03E-01
Cardioembolic stroke 8B11.20 Whole blood 2.59E-01 1.06E-01 4.20E-01
Cervical cancer 2C77 Cervical tissue 3.95E-04 2.86E-01 1.11E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.60E-01 -4.29E-02 -7.06E-02
Chronic hepatitis C 1E51.1 Whole blood 2.43E-02 -2.97E-01 -1.22E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 1.80E-01 1.93E-01 3.42E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.12E-07 -2.45E-01 -9.32E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.29E-01 2.68E-01 5.28E-01
Colon cancer 2B90 Colon tissue 7.24E-07 -3.86E-01 -5.40E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.47E-01 -6.15E-02 -3.52E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.81E-01 1.59E-01 2.87E-01
Endometriosis GA10 Endometrium tissue 9.76E-01 1.33E-01 2.07E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.62E-01 -1.98E-02 -8.74E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.52E-02 -1.12E-01 -4.09E-01
Gastric cancer 2B72 Gastric tissue 2.55E-02 7.22E-01 3.12E+00
Glioblastopma 2A00.00 Nervous tissue 7.24E-07 -6.48E-02 -1.74E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.13E-01 -5.32E-01 -1.34E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.79E-02 8.15E-01 9.99E-01
Head and neck cancer 2D42 Head and neck tissue 5.03E-19 5.17E-01 1.38E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.92E-01 -2.78E-02 -1.37E-01
Huntington's disease 8A01.10 Whole blood 3.77E-01 -2.70E-01 -6.24E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.74E-01 -6.43E-02 -2.94E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.88E-04 -2.70E-01 -2.20E+00
Influenza 1E30 Whole blood 1.36E-01 -6.47E-01 -1.53E+00
Interstitial cystitis GC00.3 Bladder tissue 3.09E-04 1.08E+00 3.41E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.65E-01 -5.22E-01 -9.49E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.05E-01 1.20E-01 3.89E-01
Ischemic stroke 8B11 Peripheral blood 1.54E-01 -2.21E-01 -5.13E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.44E-01 -1.05E-01 -2.99E-01
Lateral sclerosis 8B60.4 Skin 8.38E-02 -5.70E-01 -1.75E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.72E-02 1.44E-01 9.92E-01
Liver cancer 2C12.0 Liver tissue 2.74E-22 4.19E-01 2.06E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.29E-07 8.52E-01 5.75E+00
Lung cancer 2C25 Lung tissue 7.41E-13 -5.34E-01 -9.21E-01
Lupus erythematosus 4A40 Whole blood 2.91E-04 4.04E-01 8.42E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.72E-01 -4.56E-02 -2.94E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.76E-01 -4.18E-02 -1.13E-01
Melanoma 2C30 Skin 5.27E-01 1.54E-01 1.07E-01
Multiple myeloma 2A83.1 Peripheral blood 5.12E-01 -6.26E-02 -2.49E-01
Multiple myeloma 2A83.1 Bone marrow 2.37E-01 -1.42E-01 -4.63E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.49E-02 2.54E-01 1.16E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.73E-01 1.26E-02 2.70E-02
Myelofibrosis 2A20.2 Whole blood 2.43E-02 -2.25E-01 -1.90E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.60E-04 -4.13E-01 -5.61E-01
Myopathy 8C70.6 Muscle tissue 8.10E-04 7.40E-01 2.53E+00
Neonatal sepsis KA60 Whole blood 4.49E-01 6.28E-02 1.11E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.56E-01 -1.85E-01 -6.28E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.23E-01 3.21E-02 2.58E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.95E-03 -8.44E-01 -2.55E+00
Olive pollen allergy CA08.00 Peripheral blood 5.95E-02 -9.72E-01 -1.58E+00
Oral cancer 2B6E Oral tissue 2.31E-07 5.12E-01 1.24E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.68E-01 3.72E-01 3.79E-01
Osteoporosis FB83.1 Bone marrow 2.41E-01 4.05E-01 3.03E-01
Ovarian cancer 2C73 Ovarian tissue 3.12E-01 2.17E-02 5.06E-02
Pancreatic cancer 2C10 Pancreas 5.60E-01 2.34E-01 5.16E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.98E-01 1.71E-01 3.24E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.48E-04 -3.84E-01 -1.45E+00
Pituitary cancer 2D12 Pituitary tissue 1.18E-01 4.52E-01 7.23E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.27E-01 1.02E+00 1.48E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.03E-01 -8.91E-02 -4.56E-01
Polycythemia vera 2A20.4 Whole blood 5.17E-12 -1.89E-01 -1.32E+00
Pompe disease 5C51.3 Biceps muscle 8.28E-02 4.23E-01 1.31E+00
Preterm birth KA21.4Z Myometrium 8.97E-01 -2.16E-01 -4.20E-01
Prostate cancer 2C82 Prostate 1.08E-01 2.76E-01 4.47E-01
Psoriasis EA90 Skin 9.12E-03 -1.38E-01 -2.81E-01
Rectal cancer 2B92 Rectal colon tissue 1.64E-05 6.89E-01 3.63E+00
Renal cancer 2C90-2C91 Kidney 9.38E-01 3.82E-02 7.45E-02
Retinoblastoma 2D02.2 Uvea 7.18E-03 -3.44E-01 -8.70E-01
Rheumatoid arthritis FA20 Synovial tissue 9.14E-06 9.64E-01 2.89E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.88E-01 1.62E-02 9.01E-02
Schizophrenia 6A20 Prefrontal cortex 2.28E-01 6.94E-02 9.81E-02
Schizophrenia 6A20 Superior temporal cortex 4.01E-01 7.18E-03 3.73E-02
Scleroderma 4A42.Z Whole blood 8.38E-01 -1.24E-01 -8.68E-01
Seizure 8A60-8A6Z Whole blood 9.33E-01 7.09E-02 2.98E-01
Sensitive skin EK0Z Skin 8.60E-01 3.55E-02 8.76E-02
Sepsis with septic shock 1G41 Whole blood 1.28E-06 -1.68E-01 -2.87E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.72E-01 -2.29E-01 -3.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.78E-02 -1.68E-01 -7.63E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.22E-01 3.20E-02 2.02E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.41E-02 3.16E-01 4.74E+00
Skin cancer 2C30-2C3Z Skin 2.92E-05 3.79E-01 7.78E-01
Thrombocythemia 3B63 Whole blood 9.99E-06 -2.16E-01 -1.84E+00
Thrombocytopenia 3B64 Whole blood 4.04E-01 -7.85E-01 -9.86E-01
Thyroid cancer 2D10 Thyroid 1.94E-04 1.77E-01 4.06E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.89E-03 2.48E-01 7.43E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.54E-01 -4.50E-01 -1.37E+00
Type 2 diabetes 5A11 Liver tissue 9.75E-04 1.60E-01 2.51E+00
Ureter cancer 2C92 Urothelium 4.23E-01 -1.10E-01 -7.88E-01
Uterine cancer 2C78 Endometrium tissue 2.82E-11 3.18E-01 6.67E-01
Vitiligo ED63.0 Skin 1.74E-01 2.61E-01 6.23E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 KEGG: new perspectives on genomes, pathways, diseases and drugs. Nucleic Acids Res. 2017 Jan 4;45(D1):D353-D361. (cpd:C09264)