Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3FEV8)

DME Name Dicarbonyl/L-xylulose reductase (DCXR)
Synonyms Carbonyl reductase II; Kidney dicarbonyl reductase; L-xylulose reductase; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; XR; kiDCR; DCXR; SDR20C1
Gene Name DCXR
UniProt ID
DCXR_HUMAN
INTEDE ID
DME0412
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51181
EC Number EC: 1.1.1.10
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.10
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVAR
GLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG
FWAC
Function This enzyme catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose and participates in the uronate cycle of glucose metabolism.
KEGG Pathway
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Reactome Pathway
Formation of xylulose-5-phosphate (R-HSA-5661270 )
Essential pentosuria (R-HSA-5662853 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,2-NAPHTHOQUINONE DMYXELH Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.81E-01 -3.69E-02 -1.00E-01
Alopecia ED70 Skin from scalp 9.47E-04 2.93E-01 6.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.53E-03 1.01E-01 3.16E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.25E-01 2.19E-01 4.41E-01
Aortic stenosis BB70 Calcified aortic valve 6.28E-01 1.42E-01 2.65E-01
Apnea 7A40 Hyperplastic tonsil 5.03E-01 -1.59E-01 -3.47E-01
Arthropathy FA00-FA5Z Peripheral blood 1.30E-02 -2.90E-01 -9.68E-01
Asthma CA23 Nasal and bronchial airway 2.30E-07 4.82E-01 6.01E-01
Atopic dermatitis EA80 Skin 3.90E-04 4.74E-01 9.82E-01
Autism 6A02 Whole blood 5.15E-06 -2.67E-01 -9.36E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.31E-02 -5.32E-01 -2.62E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.25E-01 -7.72E-02 -2.07E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.42E-01 -3.72E-02 -1.11E-01
Batten disease 5C56.1 Whole blood 3.25E-01 -6.39E-02 -3.04E-01
Behcet's disease 4A62 Peripheral blood 4.29E-01 -8.63E-02 -2.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.08E-01 6.69E-02 3.27E-01
Bladder cancer 2C94 Bladder tissue 3.71E-01 3.61E-01 1.05E+00
Breast cancer 2C60-2C6Z Breast tissue 5.17E-12 3.04E-01 4.77E-01
Cardioembolic stroke 8B11.20 Whole blood 2.41E-08 6.82E-01 2.04E+00
Cervical cancer 2C77 Cervical tissue 5.55E-02 -4.29E-01 -8.72E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.84E-01 7.67E-02 1.38E-01
Chronic hepatitis C 1E51.1 Whole blood 8.44E-01 1.89E-02 9.32E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 7.28E-01 1.58E-02 3.07E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.78E-03 -1.32E-01 -2.55E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.35E-01 -1.55E-02 -4.58E-02
Colon cancer 2B90 Colon tissue 1.24E-11 -2.49E-01 -6.18E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.39E-01 3.66E-01 1.02E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.50E-01 2.98E-03 7.82E-03
Endometriosis GA10 Endometrium tissue 4.42E-04 -5.06E-01 -8.48E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.59E-01 -3.19E-03 -2.39E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.09E-01 7.63E-02 3.19E-01
Gastric cancer 2B72 Gastric tissue 3.15E-01 -1.40E+00 -1.15E+00
Glioblastopma 2A00.00 Nervous tissue 1.57E-34 -4.43E-01 -8.15E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.42E-02 -4.53E-01 -4.29E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.27E-05 8.73E-01 1.58E+00
Head and neck cancer 2D42 Head and neck tissue 8.36E-25 -8.52E-01 -1.81E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.65E-02 1.15E-01 4.26E-01
Huntington's disease 8A01.10 Whole blood 1.01E-01 -1.47E-01 -6.18E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.16E-03 -8.60E-01 -2.07E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.71E-02 2.37E-01 1.12E+00
Influenza 1E30 Whole blood 4.79E-01 -1.16E-01 -2.17E+00
Interstitial cystitis GC00.3 Bladder tissue 2.22E-01 -2.21E-01 -5.68E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.04E-01 3.67E-01 3.53E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.09E-01 -3.13E-01 -4.67E-01
Ischemic stroke 8B11 Peripheral blood 5.51E-01 1.05E-02 3.40E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.61E-07 -5.35E-01 -6.82E-01
Lateral sclerosis 8B60.4 Skin 7.48E-04 4.92E-01 8.52E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.55E-02 -5.78E-01 -1.20E+00
Liver cancer 2C12.0 Liver tissue 2.21E-11 -1.55E+00 -1.67E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.08E-03 -2.02E+00 -2.41E+00
Lung cancer 2C25 Lung tissue 2.17E-03 -1.57E-01 -3.66E-01
Lupus erythematosus 4A40 Whole blood 8.71E-01 -3.64E-02 -9.29E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.69E-01 2.02E-02 1.05E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.12E-01 -1.02E-01 -1.29E-01
Melanoma 2C30 Skin 2.93E-04 -8.59E-01 -9.47E-01
Multiple myeloma 2A83.1 Peripheral blood 4.33E-01 -3.32E-01 -6.05E-01
Multiple myeloma 2A83.1 Bone marrow 1.36E-05 1.21E+00 3.55E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.13E-02 -3.16E-01 -7.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.67E-01 1.14E-01 3.02E-01
Myelofibrosis 2A20.2 Whole blood 6.61E-01 1.33E-01 5.93E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.93E-01 -1.59E-01 -1.98E-01
Myopathy 8C70.6 Muscle tissue 6.74E-01 8.88E-02 1.92E-01
Neonatal sepsis KA60 Whole blood 3.77E-08 -3.57E-01 -9.20E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.09E-02 -5.31E-01 -1.29E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.17E-01 2.55E-01 2.92E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.99E-01 -6.38E-02 -4.32E-01
Olive pollen allergy CA08.00 Peripheral blood 7.69E-01 1.92E-01 3.02E-01
Oral cancer 2B6E Oral tissue 7.65E-09 -9.28E-01 -1.80E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.33E-01 2.05E-01 1.34E-01
Osteoporosis FB83.1 Bone marrow 1.28E-01 5.04E-01 1.40E+00
Ovarian cancer 2C73 Ovarian tissue 4.82E-01 1.02E-01 1.99E-01
Pancreatic cancer 2C10 Pancreas 2.82E-02 -4.37E-01 -8.42E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.58E-01 7.19E-02 2.50E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.24E-01 5.33E-02 2.46E-01
Pituitary cancer 2D12 Pituitary tissue 3.71E-02 -4.07E-01 -7.72E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.84E-02 -2.74E-01 -5.38E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.75E-03 -2.67E-01 -8.85E-01
Polycythemia vera 2A20.4 Whole blood 2.28E-06 -1.74E-01 -8.11E-01
Pompe disease 5C51.3 Biceps muscle 1.13E-01 -3.54E-01 -1.34E+00
Preterm birth KA21.4Z Myometrium 3.34E-01 9.60E-02 2.98E-01
Prostate cancer 2C82 Prostate 5.90E-01 8.07E-02 1.12E-01
Psoriasis EA90 Skin 3.40E-02 -6.29E-02 -1.48E-01
Rectal cancer 2B92 Rectal colon tissue 4.45E-02 -2.69E-01 -7.78E-01
Renal cancer 2C90-2C91 Kidney 2.03E-05 -2.27E+00 -2.38E+00
Retinoblastoma 2D02.2 Uvea 1.24E-02 1.79E-01 9.38E-01
Rheumatoid arthritis FA20 Synovial tissue 4.53E-02 1.24E+00 1.26E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.05E-01 2.94E-02 1.43E-01
Schizophrenia 6A20 Prefrontal cortex 2.39E-01 2.52E-02 9.82E-02
Schizophrenia 6A20 Superior temporal cortex 9.96E-01 5.22E-03 1.87E-02
Scleroderma 4A42.Z Whole blood 1.42E-03 1.89E-01 1.20E+00
Seizure 8A60-8A6Z Whole blood 5.99E-01 2.06E-01 4.93E-01
Sensitive skin EK0Z Skin 4.49E-01 -2.27E-01 -1.46E+00
Sepsis with septic shock 1G41 Whole blood 1.49E-04 -1.58E-01 -4.53E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.10E-01 3.48E-02 1.76E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.33E-01 -1.65E-02 -5.98E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 9.15E-01 -1.87E-01 -4.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.32E-01 -2.46E-01 -4.83E-01
Skin cancer 2C30-2C3Z Skin 3.58E-07 -1.71E-01 -2.92E-01
Thrombocythemia 3B63 Whole blood 4.29E-03 -1.24E-01 -5.62E-01
Thrombocytopenia 3B64 Whole blood 6.12E-01 3.91E-01 2.95E-01
Thyroid cancer 2D10 Thyroid 3.68E-34 -9.82E-01 -2.14E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.44E-02 -6.90E-01 -1.19E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.37E-01 -1.35E-01 -3.14E-01
Type 2 diabetes 5A11 Liver tissue 4.50E-01 -4.61E-02 -1.57E-01
Ureter cancer 2C92 Urothelium 6.38E-01 7.07E-02 2.76E-01
Uterine cancer 2C78 Endometrium tissue 5.07E-13 -6.65E-01 -6.38E-01
Vitiligo ED63.0 Skin 2.82E-01 -1.57E-01 -4.74E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Diacetyl/l-xylulose reductase mediates chemical redox cycling in lung epithelial cells. Chem Res Toxicol. 2017 Jul 17;30(7):1406-1418.