Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3PKUG)

DME Name Glutathione S-transferase theta-1 (GSTT1)
Synonyms Glutathione S-transferase T1-1; Glutathione transferase T1-1; GST class-theta-1; GSTT1
Gene Name GSTT1
UniProt ID
GSTT1_HUMAN
INTEDE ID
DME0093
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2952
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Function
This enzyme conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It acts on 1,2-epoxy- 3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide and displays glutathione peroxidase activity with cumene hydroperoxide.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Carboplatin DMG281S Adenocarcinoma 2D40 Approved [1]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [2]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [3]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.82E-08 -5.39E-01 -9.24E-01
Alopecia ED70 Skin from scalp 5.49E-01 -1.43E-01 -9.47E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.24E-03 3.03E-01 3.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.84E-01 3.01E-01 3.06E-01
Aortic stenosis BB70 Calcified aortic valve 9.35E-01 1.99E-01 2.51E-01
Apnea 7A40 Hyperplastic tonsil 8.23E-01 -2.15E-02 -4.31E-02
Arthropathy FA00-FA5Z Peripheral blood 9.93E-01 -1.47E-01 -3.26E-01
Asthma CA23 Nasal and bronchial airway 1.88E-01 4.50E-01 3.12E-01
Atopic dermatitis EA80 Skin 7.30E-01 -1.76E-01 -1.65E-01
Autism 6A02 Whole blood 8.33E-01 -7.05E-02 -2.28E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.29E-02 1.13E-01 3.09E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.52E-01 -1.99E-01 -6.88E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.08E-01 7.98E-02 1.06E-01
Batten disease 5C56.1 Whole blood 8.37E-01 2.00E-01 4.15E-01
Behcet's disease 4A62 Peripheral blood 1.72E-01 8.85E-02 1.90E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.71E-01 1.05E-01 1.07E-01
Bladder cancer 2C94 Bladder tissue 1.70E-03 -1.06E+00 -1.73E+00
Breast cancer 2C60-2C6Z Breast tissue 6.24E-04 -2.25E-01 -2.17E-01
Cardioembolic stroke 8B11.20 Whole blood 2.82E-01 -3.55E-02 -4.26E-02
Cervical cancer 2C77 Cervical tissue 4.79E-01 -2.93E-01 -3.13E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.41E-01 -5.91E-02 -1.96E-01
Chronic hepatitis C 1E51.1 Whole blood 1.60E-01 -3.41E-01 -1.22E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 8.72E-02 -1.31E-01 -1.43E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.68E-01 4.67E-02 3.55E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.63E-01 -4.65E-01 -6.93E-01
Colon cancer 2B90 Colon tissue 4.16E-03 -3.47E-01 -3.07E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.24E-02 -1.13E-01 -1.44E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.20E-01 1.63E-01 2.69E-01
Endometriosis GA10 Endometrium tissue 1.05E-02 -7.91E-01 -7.72E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.59E-03 -4.06E-01 -1.49E+00
Familial hypercholesterolemia 5C80.00 Whole blood 6.02E-01 -4.08E-02 -1.54E-01
Gastric cancer 2B72 Gastric tissue 8.50E-01 1.47E+00 8.33E-01
Glioblastopma 2A00.00 Nervous tissue 1.33E-06 -2.96E-01 -2.98E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.68E-01 -7.85E-01 -1.10E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.21E-01 -2.93E-02 -5.44E-02
Head and neck cancer 2D42 Head and neck tissue 2.53E-04 -6.74E-01 -5.95E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.83E-01 1.51E-01 4.12E-01
Huntington's disease 8A01.10 Whole blood 9.01E-01 -4.08E-02 -1.71E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.69E-01 4.87E-01 3.80E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.76E-01 1.80E-01 5.27E-01
Influenza 1E30 Whole blood 7.29E-01 1.29E-01 4.82E-01
Interstitial cystitis GC00.3 Bladder tissue 1.20E-02 -1.50E+00 -2.61E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.56E-01 2.31E-01 1.83E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.37E-01 -3.62E-01 -2.95E-01
Ischemic stroke 8B11 Peripheral blood 7.16E-01 -1.34E-02 -5.02E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.42E-03 -2.71E-01 -5.41E-01
Lateral sclerosis 8B60.4 Skin 8.48E-01 -5.06E-01 -4.06E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.07E-01 -2.70E-01 -2.97E-01
Liver cancer 2C12.0 Liver tissue 3.22E-03 -6.59E-01 -4.84E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.97E-02 1.93E+00 1.15E+00
Lung cancer 2C25 Lung tissue 1.62E-04 -2.46E-01 -2.38E-01
Lupus erythematosus 4A40 Whole blood 8.83E-02 1.08E-02 2.66E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.28E-01 6.17E-02 6.41E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.45E-01 1.84E-02 3.72E-02
Melanoma 2C30 Skin 6.98E-01 -5.06E-01 -3.64E-01
Multiple myeloma 2A83.1 Peripheral blood 7.19E-01 7.47E-02 1.79E-01
Multiple myeloma 2A83.1 Bone marrow 4.00E-01 1.47E-01 3.86E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.52E-01 5.96E-02 1.74E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.26E-01 3.23E-01 5.33E-01
Myelofibrosis 2A20.2 Whole blood 9.10E-02 1.19E-01 5.05E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.26E-02 -1.26E-01 -2.00E-01
Myopathy 8C70.6 Muscle tissue 5.78E-01 -1.34E-01 -1.26E-01
Neonatal sepsis KA60 Whole blood 1.97E-01 4.00E-02 1.30E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.08E-02 -9.20E-01 -1.23E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.75E-01 -6.71E-02 -2.47E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.37E-01 -3.75E-01 -4.01E-01
Olive pollen allergy CA08.00 Peripheral blood 4.40E-01 3.99E-01 1.08E+00
Oral cancer 2B6E Oral tissue 1.02E-01 -3.30E-01 -4.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.21E-01 -6.76E-01 -9.59E-01
Osteoporosis FB83.1 Bone marrow 8.55E-01 -8.43E-02 -8.78E-02
Ovarian cancer 2C73 Ovarian tissue 7.67E-02 -4.13E-01 -3.82E-01
Pancreatic cancer 2C10 Pancreas 5.00E-01 1.17E-01 1.12E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.32E-01 -2.67E-01 -2.63E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.96E-01 8.43E-02 2.97E-01
Pituitary cancer 2D12 Pituitary tissue 5.00E-01 -1.04E-01 -9.28E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.31E-01 1.65E-01 1.34E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.30E-01 -8.93E-02 -3.97E-01
Polycythemia vera 2A20.4 Whole blood 2.40E-01 -1.03E-02 -4.09E-02
Pompe disease 5C51.3 Biceps muscle 5.49E-01 -1.63E-01 -1.35E-01
Preterm birth KA21.4Z Myometrium 8.85E-02 4.89E-01 4.93E-01
Prostate cancer 2C82 Prostate 3.00E-02 -5.45E-01 -3.72E-01
Psoriasis EA90 Skin 6.44E-01 -2.51E-01 -2.00E-01
Rectal cancer 2B92 Rectal colon tissue 8.95E-06 -6.33E-01 -1.96E+00
Renal cancer 2C90-2C91 Kidney 5.52E-01 2.50E-02 2.12E-02
Retinoblastoma 2D02.2 Uvea 8.50E-01 1.04E+00 2.32E+00
Rheumatoid arthritis FA20 Synovial tissue 9.13E-01 -1.12E-01 -1.44E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.29E-01 -3.76E-02 -4.27E-02
Schizophrenia 6A20 Prefrontal cortex 3.90E-01 -1.96E-01 -2.25E-01
Schizophrenia 6A20 Superior temporal cortex 7.83E-01 2.65E-02 5.24E-02
Scleroderma 4A42.Z Whole blood 9.51E-01 -3.36E-02 -9.11E-02
Seizure 8A60-8A6Z Whole blood 5.95E-01 -2.23E-02 -6.89E-02
Sensitive skin EK0Z Skin 6.61E-01 -3.05E-01 -2.53E-01
Sepsis with septic shock 1G41 Whole blood 5.47E-04 1.10E-01 3.16E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.20E-01 -8.46E-02 -3.63E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.56E-01 3.04E-01 1.12E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.10E-01 -3.76E-01 -6.80E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.48E-01 -1.70E-01 -1.58E-01
Skin cancer 2C30-2C3Z Skin 5.75E-12 -9.33E-01 -8.01E-01
Thrombocythemia 3B63 Whole blood 7.57E-03 -7.83E-02 -3.16E-01
Thrombocytopenia 3B64 Whole blood 5.76E-01 1.19E+00 1.17E+00
Thyroid cancer 2D10 Thyroid 4.70E-02 -2.38E-01 -1.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.66E-01 -1.58E-01 -3.14E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.09E-01 -7.43E-01 -4.79E-01
Type 2 diabetes 5A11 Liver tissue 1.29E-01 -2.73E-01 -1.22E+00
Ureter cancer 2C92 Urothelium 2.99E-01 -1.14E-01 -5.05E-01
Uterine cancer 2C78 Endometrium tissue 1.37E-06 -6.88E-01 -5.26E-01
Vitiligo ED63.0 Skin 1.11E-01 6.87E-01 5.51E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA150642262)
2 Glutathione S-transferase genetic polymorphisms and individual sensitivity to the ototoxic effect of cisplatin. Anticancer Drugs. 2000 Sep;11(8):639-43.
3 Reactions of glutathione with the catechol, the ortho-quinone and the semi-quinone free radical of etoposide. Consequences for DNA inactivation. Biochem Pharmacol. 1992 Apr 15;43(8):1761-8.