Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3Z1RA)

DME Name Pyridoxamine-phosphate oxidase (PNPO)
Synonyms Pyridoxine-5'-phosphate oxidase; Pyridoxaminephosphateoxidase; Pyridoxamine-phosphateoxidase; PNPO
Gene Name PNPO
UniProt ID
PNPO_HUMAN
INTEDE ID
DME0209
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
55163
EC Number EC: 1.4.3.5
Oxidoreductase
CH-NH2 donor oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.4.3.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVK
QFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKE
LDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPD
REYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGD
SPLGPMTHRGEEDWLYERLAP
Function This enzyme catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).
KEGG Pathway
Metabolic pathways (hsa01100 )
Vitamin B6 metabolism (hsa00750 )
Reactome Pathway
Vitamins B6 activation to pyridoxal phosphate (R-HSA-964975 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Pyridoxamine DMVDCGZ Diabetic kidney disease GB61.Z Phase 3 [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Pyridoxine-5'-Phosphate DMFUNL1 Discovery agent N.A. Investigative [2]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Pyridoxine-5'-Phosphate Discovery agent [N.A.] Investigative Km = 0.00618 microM [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.78E-02 1.75E-01 4.09E-01
Alopecia ED70 Skin from scalp 1.20E-04 1.61E-01 6.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.99E-02 -1.61E-01 -6.72E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.11E-01 2.15E-01 8.12E-01
Aortic stenosis BB70 Calcified aortic valve 5.78E-01 -9.93E-03 -2.59E-02
Apnea 7A40 Hyperplastic tonsil 9.66E-02 -2.25E-01 -5.70E-01
Arthropathy FA00-FA5Z Peripheral blood 3.18E-01 -2.20E-01 -9.02E-01
Asthma CA23 Nasal and bronchial airway 3.84E-08 3.19E-01 5.31E-01
Atopic dermatitis EA80 Skin 4.19E-05 3.30E-01 2.40E+00
Autism 6A02 Whole blood 2.79E-01 -1.59E-01 -7.54E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.66E-01 -1.36E-01 -5.96E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.77E-01 -5.55E-02 -3.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.96E-02 -5.48E-02 -2.53E-01
Batten disease 5C56.1 Whole blood 2.73E-01 1.54E-02 1.40E-01
Behcet's disease 4A62 Peripheral blood 9.79E-01 -1.03E-02 -5.20E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.42E-01 5.50E-03 4.57E-02
Bladder cancer 2C94 Bladder tissue 8.56E-05 4.91E-01 3.51E+00
Breast cancer 2C60-2C6Z Breast tissue 5.08E-06 1.18E-01 3.29E-01
Cardioembolic stroke 8B11.20 Whole blood 8.24E-01 -1.98E-02 -1.02E-01
Cervical cancer 2C77 Cervical tissue 4.17E-03 -2.42E-01 -7.93E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.58E-01 3.01E-01 5.14E-01
Chronic hepatitis C 1E51.1 Whole blood 6.09E-01 2.14E-02 8.08E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 5.46E-01 -5.53E-02 -2.11E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.66E-01 -1.17E-02 -4.91E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.98E-01 1.77E-03 9.20E-03
Colon cancer 2B90 Colon tissue 3.68E-49 5.77E-01 1.78E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.36E-01 1.61E-01 4.99E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.09E-01 -8.34E-02 -2.21E-01
Endometriosis GA10 Endometrium tissue 1.83E-04 -2.91E-01 -1.17E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.48E-01 4.71E-02 2.38E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.78E-03 2.79E-01 1.52E+00
Gastric cancer 2B72 Gastric tissue 9.75E-02 7.20E-01 1.44E+00
Glioblastopma 2A00.00 Nervous tissue 4.24E-04 1.05E-01 3.01E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.94E-03 -2.98E-01 -2.89E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.42E-02 4.52E-01 9.33E-01
Head and neck cancer 2D42 Head and neck tissue 1.18E-02 6.97E-02 2.83E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.66E-01 2.93E-02 8.21E-02
Huntington's disease 8A01.10 Whole blood 1.93E-01 -7.53E-02 -4.53E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.29E-02 5.78E-01 2.11E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.65E-05 3.31E-01 5.49E+00
Influenza 1E30 Whole blood 6.95E-03 -3.24E-01 -2.69E+00
Interstitial cystitis GC00.3 Bladder tissue 2.35E-02 -2.16E-01 -1.59E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.52E-09 6.34E-01 4.40E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.98E-01 1.59E-03 5.00E-03
Ischemic stroke 8B11 Peripheral blood 4.51E-01 -1.09E-01 -4.45E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.30E-09 -1.68E-01 -7.35E-01
Lateral sclerosis 8B60.4 Skin 3.48E-02 6.52E-01 1.97E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.93E-01 4.93E-02 1.91E-01
Liver cancer 2C12.0 Liver tissue 8.63E-09 -3.69E-01 -1.00E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.17E-04 -1.22E+00 -5.61E+00
Lung cancer 2C25 Lung tissue 2.21E-34 2.99E-01 1.12E+00
Lupus erythematosus 4A40 Whole blood 3.31E-01 1.24E-01 2.70E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.43E-01 1.66E-02 1.43E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.76E-01 1.35E-02 6.62E-02
Melanoma 2C30 Skin 2.01E-01 -7.39E-02 -1.16E-01
Multiple myeloma 2A83.1 Peripheral blood 6.74E-01 -7.33E-02 -1.65E-01
Multiple myeloma 2A83.1 Bone marrow 1.05E-04 7.75E-01 2.53E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.69E-01 -1.02E-01 -2.56E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.73E-03 2.59E-01 5.41E-01
Myelofibrosis 2A20.2 Whole blood 8.91E-01 4.75E-02 5.46E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.39E-04 -2.34E-01 -4.15E-01
Myopathy 8C70.6 Muscle tissue 4.50E-01 -4.07E-02 -1.99E-01
Neonatal sepsis KA60 Whole blood 1.11E-15 -3.56E-01 -1.60E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.59E-01 1.21E-01 3.84E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.55E-01 -1.77E-01 -6.28E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.90E-01 1.82E-01 6.35E-01
Olive pollen allergy CA08.00 Peripheral blood 6.49E-01 1.07E-01 4.20E-01
Oral cancer 2B6E Oral tissue 3.54E-02 1.58E-01 3.60E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.08E-01 3.71E-01 7.45E-01
Osteoporosis FB83.1 Bone marrow 3.52E-01 -1.11E-01 -2.91E-01
Ovarian cancer 2C73 Ovarian tissue 9.53E-04 8.56E-01 1.89E+00
Pancreatic cancer 2C10 Pancreas 2.77E-02 8.17E-02 3.57E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.31E-01 -3.14E-01 -7.20E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.37E-01 3.26E-02 2.15E-01
Pituitary cancer 2D12 Pituitary tissue 1.60E-03 4.53E-01 1.46E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.17E-01 2.07E-01 6.51E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.35E-02 7.72E-02 5.00E-01
Polycythemia vera 2A20.4 Whole blood 1.09E-01 -6.79E-02 -7.05E-01
Pompe disease 5C51.3 Biceps muscle 4.46E-04 -5.23E-01 -2.39E+00
Preterm birth KA21.4Z Myometrium 3.22E-01 -1.39E-01 -4.45E-01
Prostate cancer 2C82 Prostate 4.77E-06 1.06E+00 2.19E+00
Psoriasis EA90 Skin 4.27E-33 5.82E-01 2.29E+00
Rectal cancer 2B92 Rectal colon tissue 1.26E-02 2.43E-01 1.29E+00
Renal cancer 2C90-2C91 Kidney 1.31E-01 -4.83E-01 -7.35E-01
Retinoblastoma 2D02.2 Uvea 3.16E-12 1.07E+00 6.06E+00
Rheumatoid arthritis FA20 Synovial tissue 1.12E-03 5.03E-01 2.04E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.38E-01 -4.98E-02 -4.71E-01
Schizophrenia 6A20 Prefrontal cortex 1.53E-03 -9.68E-02 -4.95E-01
Schizophrenia 6A20 Superior temporal cortex 3.28E-01 -4.93E-02 -3.19E-01
Scleroderma 4A42.Z Whole blood 6.23E-01 -2.73E-02 -1.84E-01
Seizure 8A60-8A6Z Whole blood 2.45E-01 -7.88E-02 -3.25E-01
Sensitive skin EK0Z Skin 7.48E-01 2.05E-02 1.69E-01
Sepsis with septic shock 1G41 Whole blood 8.04E-45 -3.51E-01 -1.93E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.15E-01 -7.28E-02 -7.23E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.67E-01 -3.15E-02 -1.60E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.97E-01 -3.44E-01 -7.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.06E-01 -1.51E-02 -1.13E-01
Skin cancer 2C30-2C3Z Skin 1.82E-15 4.98E-01 1.01E+00
Thrombocythemia 3B63 Whole blood 8.20E-01 -1.11E-02 -1.35E-01
Thrombocytopenia 3B64 Whole blood 5.77E-01 3.13E-01 4.33E-01
Thyroid cancer 2D10 Thyroid 4.95E-16 -4.06E-01 -1.27E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.19E-06 -5.04E-01 -2.61E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.48E-01 2.93E-02 1.18E-01
Type 2 diabetes 5A11 Liver tissue 5.20E-01 -1.25E-01 -6.52E-01
Ureter cancer 2C92 Urothelium 3.48E-01 6.55E-02 5.73E-01
Uterine cancer 2C78 Endometrium tissue 2.07E-02 -2.22E-01 -3.48E-01
Vitiligo ED63.0 Skin 7.06E-01 5.87E-02 6.14E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 An LC-MS/MS-based method for the quantification of pyridox(am)ine 5'-phosphate oxidase activity in dried blood spots from patients with epilepsy. Anal Chem. 2017 Sep 5;89(17):8892-8900.
2 Pyridoxine 5'-phosphate oxidase is a novel therapeutic target and regulated by the TGF-beta signalling pathway in epithelial ovarian cancer. Cell Death Dis. 2017 Dec 13;8(12):3214.
3 Inactive mutants of human pyridoxine 5'-phosphate oxidase: a possible role for a noncatalytic pyridoxal 5'-phosphate tight binding site. FEBS Open Bio. 2016 Mar 22;6(5):398-408.