Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE48Q2Z)

DME Name UDP-glucose 6-dehydrogenase (UGDH)
Synonyms UDP-Glc dehydrogenase; UDP-glucose dehydrogenase; UDP-GlcDH; UDPGDH; UGDH
Gene Name UGDH
UniProt ID
UGDH_HUMAN
INTEDE ID
DME0465
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7358
EC Number EC: 1.1.1.22
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.22
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIP
KFSLQDPPNKKPKV
Function This enzyme catalyzes the formation of UDP-alpha-D-glucuronate, a constituent of complex glycosaminoglycans. It is required for the biosynthesis of chondroitin sulfate and heparan sulfate.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Ascorbate and aldarate metabolism (hsa00053 )
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Reactome Pathway
Formation of the active cofactor, UDP-glucuronate (R-HSA-173599 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
UDP-glucose DMLT4JA Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
UDP-glucose Discovery agent [N.A.] Investigative Km = 0.011 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.41E-01 -9.31E-02 -1.31E-01
Alopecia ED70 Skin from scalp 6.85E-01 -7.31E-02 -2.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.06E-01 -3.05E-02 -9.59E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.37E-01 -7.53E-02 -3.66E-01
Aortic stenosis BB70 Calcified aortic valve 2.79E-01 3.41E-01 4.17E-01
Apnea 7A40 Hyperplastic tonsil 2.25E-01 -7.15E-01 -1.74E+00
Arthropathy FA00-FA5Z Peripheral blood 2.77E-01 -1.13E-01 -3.17E-01
Asthma CA23 Nasal and bronchial airway 8.86E-03 1.30E-01 1.51E-01
Atopic dermatitis EA80 Skin 9.73E-01 2.90E-02 1.10E-01
Autism 6A02 Whole blood 6.44E-01 -1.84E-02 -3.89E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.58E-01 3.09E-01 5.71E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.62E-01 -1.25E-02 -2.60E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.58E-01 -6.82E-02 -1.70E-01
Batten disease 5C56.1 Whole blood 5.74E-01 -1.45E-01 -9.66E-01
Behcet's disease 4A62 Peripheral blood 7.93E-01 -1.06E-01 -3.82E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.16E-01 8.92E-02 3.53E-01
Bladder cancer 2C94 Bladder tissue 1.58E-07 -8.13E-01 -4.83E+00
Breast cancer 2C60-2C6Z Breast tissue 7.52E-09 1.46E-01 2.21E-01
Cardioembolic stroke 8B11.20 Whole blood 1.97E-01 6.14E-02 1.92E-01
Cervical cancer 2C77 Cervical tissue 9.28E-02 -3.96E-01 -6.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.55E-01 -9.01E-02 -9.97E-02
Chronic hepatitis C 1E51.1 Whole blood 1.38E-01 -2.35E-01 -6.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.56E-01 -1.04E-01 -2.25E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.65E-01 6.90E-04 1.78E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.12E-02 -9.05E-01 -4.77E+00
Colon cancer 2B90 Colon tissue 1.65E-142 -1.90E+00 -4.91E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.71E-01 2.16E-01 1.22E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.98E-01 -1.64E-01 -3.84E-01
Endometriosis GA10 Endometrium tissue 7.65E-01 6.04E-02 1.47E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.61E-01 -6.55E-02 -2.31E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.48E-06 4.93E-01 9.69E-01
Gastric cancer 2B72 Gastric tissue 6.20E-01 2.13E-01 3.00E-01
Glioblastopma 2A00.00 Nervous tissue 8.92E-177 1.61E+00 2.51E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.92E-07 1.09E+00 1.41E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.07E-01 -3.14E-02 -5.77E-02
Head and neck cancer 2D42 Head and neck tissue 2.38E-03 -2.83E-01 -4.28E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.97E-01 9.85E-03 4.85E-02
Huntington's disease 8A01.10 Whole blood 4.15E-01 -5.41E-02 -2.65E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.96E-01 -7.37E-02 -1.67E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.79E-01 4.07E-02 6.58E-01
Influenza 1E30 Whole blood 8.73E-03 -8.63E-01 -2.84E+00
Interstitial cystitis GC00.3 Bladder tissue 3.62E-07 -9.03E-01 -6.79E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.84E-01 5.31E-02 6.35E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.77E-02 8.88E-02 3.99E-01
Ischemic stroke 8B11 Peripheral blood 8.18E-02 -2.25E-01 -8.43E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.71E-01 1.62E-02 3.30E-02
Lateral sclerosis 8B60.4 Skin 1.20E-01 1.79E-01 1.27E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.79E-01 6.94E-02 2.05E-01
Liver cancer 2C12.0 Liver tissue 1.23E-07 3.87E-01 1.21E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.16E-01 -1.10E+00 -5.73E+00
Lung cancer 2C25 Lung tissue 7.22E-76 7.78E-01 2.15E+00
Lupus erythematosus 4A40 Whole blood 2.38E-01 3.57E-01 4.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.90E-01 -1.01E-01 -3.88E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.06E-01 -3.81E-02 -7.28E-02
Melanoma 2C30 Skin 6.82E-01 -1.63E-02 -2.27E-02
Multiple myeloma 2A83.1 Peripheral blood 1.20E-01 -9.61E-02 -2.83E-01
Multiple myeloma 2A83.1 Bone marrow 2.28E-06 8.60E-01 4.28E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.18E-02 -3.32E-01 -1.47E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.70E-02 -6.48E-05 -9.98E-05
Myelofibrosis 2A20.2 Whole blood 6.24E-01 6.25E-02 1.62E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.60E-02 -8.09E-01 -6.37E-01
Myopathy 8C70.6 Muscle tissue 1.42E-01 3.58E-01 6.55E-01
Neonatal sepsis KA60 Whole blood 4.36E-05 -3.83E-01 -7.32E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.03E-07 2.57E+00 4.20E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.29E-01 3.23E-01 4.41E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.13E-02 -3.80E-01 -6.13E-01
Olive pollen allergy CA08.00 Peripheral blood 8.72E-01 2.01E-01 3.69E-01
Oral cancer 2B6E Oral tissue 2.61E-04 4.88E-01 5.31E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.19E-01 3.51E-01 2.09E-01
Osteoporosis FB83.1 Bone marrow 2.19E-02 -5.20E-01 -1.72E+00
Ovarian cancer 2C73 Ovarian tissue 8.89E-01 4.01E-02 9.25E-02
Pancreatic cancer 2C10 Pancreas 3.84E-01 -1.77E-01 -2.08E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.65E-02 2.50E-01 6.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.54E-01 1.89E-01 8.78E-01
Pituitary cancer 2D12 Pituitary tissue 5.87E-01 1.54E-01 2.95E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.63E-01 -7.03E-02 -1.42E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.68E-01 -1.54E-01 -4.68E-01
Polycythemia vera 2A20.4 Whole blood 1.10E-01 -5.30E-02 -1.34E-01
Pompe disease 5C51.3 Biceps muscle 8.73E-01 1.26E-02 6.08E-02
Preterm birth KA21.4Z Myometrium 2.81E-01 -2.48E-01 -8.36E-01
Prostate cancer 2C82 Prostate 2.41E-05 7.58E-01 1.49E+00
Psoriasis EA90 Skin 5.69E-04 2.39E-01 5.09E-01
Rectal cancer 2B92 Rectal colon tissue 1.16E-04 -1.28E+00 -3.64E+00
Renal cancer 2C90-2C91 Kidney 4.33E-02 4.14E-01 7.58E-01
Retinoblastoma 2D02.2 Uvea 2.20E-06 1.03E+00 2.64E+00
Rheumatoid arthritis FA20 Synovial tissue 1.51E-01 4.67E-01 3.84E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.65E-01 -1.77E-01 -4.10E-01
Schizophrenia 6A20 Prefrontal cortex 3.02E-01 1.64E-01 3.03E-01
Schizophrenia 6A20 Superior temporal cortex 1.27E-01 1.08E-01 5.19E-01
Scleroderma 4A42.Z Whole blood 2.69E-01 3.51E-02 1.48E-01
Seizure 8A60-8A6Z Whole blood 4.46E-01 3.91E-01 7.20E-01
Sensitive skin EK0Z Skin 9.92E-01 -4.83E-02 -6.70E-01
Sepsis with septic shock 1G41 Whole blood 1.14E-13 -4.17E-01 -8.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.53E-02 -1.77E-01 -5.07E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.68E-02 -5.16E-01 -1.02E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.29E-01 -2.10E-01 -6.64E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.72E-01 5.08E-01 1.35E+00
Skin cancer 2C30-2C3Z Skin 6.86E-15 6.14E-01 9.75E-01
Thrombocythemia 3B63 Whole blood 3.40E-01 -9.33E-02 -2.36E-01
Thrombocytopenia 3B64 Whole blood 6.53E-01 -1.07E-01 -7.64E-02
Thyroid cancer 2D10 Thyroid 5.47E-01 -1.25E-01 -3.84E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.73E-09 1.42E+00 3.10E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.26E-02 4.36E-01 2.05E+00
Type 2 diabetes 5A11 Liver tissue 3.36E-02 3.47E-01 3.09E+00
Ureter cancer 2C92 Urothelium 1.86E-01 1.30E-01 3.15E-01
Uterine cancer 2C78 Endometrium tissue 1.44E-03 -2.03E-01 -2.76E-01
Vitiligo ED63.0 Skin 1.56E-03 -2.40E-01 -1.69E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Importance of Gly-13 for the coenzyme binding of human UDP-glucose dehydrogenase. J Biol Chem. 2004 Sep 3;279(36):37491-8.
2 Characterization of human UDP-glucose dehydrogenase. CYS-276 is required for the second of two successive oxidations. J Biol Chem. 2004 May 28;279(22):23590-6.