Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE69QHT)
DME Name | Aminoglycoside acetyltransferase (aac) | ||||
---|---|---|---|---|---|
Synonyms | Aminoglycoside 2'-N-acetyltransferase; AAC(2')-Ia; aac | ||||
Gene Name | aac | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 2.3.1.59 | ||||
Lineage | Species: Providencia stuartii | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MGIEYRSLHTSQLTLSEKEALYDLLIEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVA
IIQRHMALDNTPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLGLLSASDDGQ KLYHSVGWQIWKGKLFELKQGSYIRSIEEEGGVMGWKADGEVDFTASLYCDFRGGDQW |
||||
Function | This enzyme catalyzes the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides. | ||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||